KEGG   Shimwellia blattae: EBL_c11800Help
Entry
EBL_c11800        CDS       T02111                                 

Definition
(GenBank) IcmF-related protein
  KO
K11891  type VI secretion system protein ImpL
Organism
ebt  Shimwellia blattae
Pathway
ebt03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:ebt00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    EBL_c11800
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:ebt02044]
    EBL_c11800
Secretion system [BR:ebt02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   EBL_c11800
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: IcmF-related IcmF_C ImcF-related_N B_lectin
Motif
Other DBs
NCBI-ProteinID: AFJ46284
UniProt: I2B6Y0
Position
1215163..1218534
Genome map
AA seq 1123 aa AA seqDB search
MKILSTFLLALLLGALSVCLIGGALWFYPEWVKDTFNTGPFSTTGIVIISLLLMLAALII
GWVLETVFMKNGEKQGKLDVITSGQQAAASQPEAKHTDADTSRFVAEVLVDHLRLRYSRR
WKAKVRLLLVQGSESDIEKVVPGLKRDHWQESDGIVLIHGGLPESVPDDEFLSVLKDVRP
QRPLDGVVQVMNAATLPDTARQDILVRVRQKADTLLGWQLPVWLWLVREGTWFRDGEGVP
PTGVLFGPGATTEEARSALATLSSELQTPGVAALLENSQHHWLLNLSKALRGTLRRDLVP
LLTTLMSGPAPYRLRGVMLSPALPGTETVPHARLSPPVWQALENDSLQVHARKIGFHWQK
VLRLVVLGLVLLWGAGTLLSLSVNRTQIWLAQDTARVAADTRQPLPDRLRNQLALQQTIA
RLQNREVHGAPWYTRFGLNQDRDTLKLLWPLYARNSQQLMRDALADELHRQLSAFVQLPP
ASSARTSATRKTYSLLKGYLMLARPDKADANWLADNMLKTWPHRSSVPDSVWQTQAPKLL
GFWAQNLPAHPEWKITPDHEIVSTVRQILLRQIGQRNAESGLYQEMLGRIARNWPDLTLA
DITGDTDASSLFSSEEVVPGMFTHQAWEEQVEDAIDEVVKARRDEIDWVLTDKTHQPGGD
VSPEMLKQRLTERYFTDFGNAWLNMANSIQWHEAASLSEAIAQLNLLADVRQSPLVALMN
TLAWQGQTGTKGERLADSLVDSAKKLVGRKKSAKQFIDQAQGPKGPLDGVFGPLTSLMAG
KDGTGSNGNLSFQSWLARVTQVRLKLQQVTSAPDPQAMAQMLAQTVFQGKAIDLTDTRDY
GSLVAASLGQEWNGFGQALFVQPLDLAWRQVLAPAAGSLNARWQSTIVSQWNTAFAGRYP
FKATGSDASLPLLAQFLRRDSGRIAAFIKTNLGGMLHQEGSHWVVDQAASQGMHISPAFL
VAINKIADISDIVFAQGDAGVHFELMARPSRDVARTQLTLDGQKLDYFNQMESWQSFTWP
GNTYYPGADLSWRSTSSEMRLYASNQGNWGFIRLLDKAQITPLDSSRTQLVWITPDGSPL
KFIMRSELGDGPLALLELQGFSLPQTIFTVGTVDSTSTLAGDE
NT seq 3372 nt NT seq  +upstreamnt  +downstreamnt
atgaaaatattatccacctttctgcttgcgctgctcctgggcgcattatctgtctgcctt
attggcggcgcactctggttttatcctgagtgggttaaggacaccttcaacacaggcccg
ttcagcacgaccggcatagtgatcatcagcctgctgctgatgctggcggcgctgattatc
ggttgggtacttgaaaccgtatttatgaagaacggtgaaaagcagggaaagctggatgtg
atcacctccggacagcaggctgctgcatcccagcctgaagcaaagcataccgacgcagac
acctcccggtttgtggctgaggtgctggtcgatcacctgcgtctgcgttacagccgccgc
tggaaagccaaagtccgtttgttactggtgcagggcagtgaaagcgatatcgaaaaagtg
gtgccgggccttaaacgtgaccactggcaggagagcgacgggattgtgcttattcacggc
ggcctgccggaaagcgtgcctgatgatgaatttctgtccgtcctgaaagacgtgcgccca
cagcgaccgctggatggcgtggtgcaggtgatgaatgcggctacactgccggatacggcg
aggcaggatatcctggtacgtgtgcggcagaaggccgatacgttgctgggctggcagctg
ccggtctggttgtggcttgtccgggaaggcacctggttccgtgacggggagggagtgccg
ccgacaggcgtcctgttcggcccgggggcgacaacggaagaggcccgctcggcactggcc
acgctctcgtcggagctgcaaactcccggtgtggcggcactgctggagaattcacaacat
cactggctgttgaacctgtcaaaagccctgcgcggcacgctgcgacgcgacctggtgccg
ctgctgactacgctgatgtcggggccagccccttaccgactgcgcggagtgatgctcagc
ccggcattgccgggaaccgaaacggtgccacatgcgcgcctgtcgccaccggtctggcag
gcacttgaaaatgacagcctgcaggtgcatgcccgtaaaatcggcttccactggcaaaag
gtgctgcgtctggtggtgctggggctggttcttctctggggggcaggcacgttgctgtcg
ctgtccgtcaaccgcactcaaatctggctcgctcaggatacggcacgggtggcggccgat
acccggcagcctttgccggatcgcctgcgtaaccagctggccttgcagcagaccattgcc
cgcctgcagaaccgtgaagtacacggtgcgccgtggtacacccgctttggcctgaaccag
gacagggatacactgaagttgctctggcctttatacgcccgtaacagccagcaactgatg
cgcgatgcgctggcagatgaacttcaccgccagctcagcgcctttgttcagttgcctccg
gcaagcagcgcacgtacgtctgccacccggaagacgtacagcctgcttaaaggttacctg
atgctggcccgtcccgataaagcggatgcaaactggcttgccgataatatgctgaaaacc
tggccgcaccgcagcagcgtgccggacagcgtatggcagacccaggccccgaagctgctc
ggcttctgggcgcagaacttgccggcacacccggagtggaaaatcacccctgaccacgaa
atagtgagcacggtacgccagattctgctcaggcagattggtcagcgtaacgcggaaagc
ggcctgtatcaggagatgctcgggcgtattgcccgtaactggccggatttaaccctcgcg
gacataaccggcgatacggatgcttcgtccctgttctcctctgaggaagtggtgccaggg
atgttcacccaccaggcatgggaagagcaggttgaagatgcgattgatgaggtagtgaag
gcccgccgtgatgaaatcgactgggtactcaccgacaaaacccatcagccaggcggtgat
gtctcaccggagatgctgaaacagcgcctgacggagcgttattttactgattttggcaac
gcctggctcaatatggccaacagcattcagtggcacgaagcggcctcgctctccgaagcc
attgcccagctgaatctgctggcggatgttcgtcagtcaccgctggtggcgctgatgaat
actcttgcctggcagggacagaccggaactaaaggagagcgacttgcagactctctggtg
gactcggcgaaaaaactggtcgggcgtaagaagagcgctaagcagtttattgatcaggcg
cagggtccaaaagggccgctcgacggcgtgtttggcccgctcacgagcctgatggctggt
aaggacggtaccggctcgaacggcaacctcagtttccagtcctggcttgcccgtgtaacc
caggtgcgactcaaactccagcaggtaaccagcgctcccgatccccaggcgatggcgcag
atgctggctcagaccgtcttccagggaaaagccatcgacctgaccgacacccgtgattat
ggttctctggtggcggcaagtctcgggcaggagtggaacggattcgggcaggcgctgttt
gtgcagccgcttgacctggcctggcgtcaggtgctggccccggccgcaggcagccttaat
gcccgctggcagagcaccattgtttcgcagtggaacaccgcctttgccggacgctatccg
ttcaaggccaccggcagcgatgcctccctgccgttactggcccagttcctgcggcgcgac
tccgggcgcattgcggcgttcatcaaaactaacctcggcggcatgctgcatcaggagggc
agtcactgggtggtggatcaggccgccagccagggaatgcatatcagccccgcgtttctt
gtcgccattaataagattgccgatatctcggatatcgtctttgctcagggcgatgccggg
gtacatttcgagctgatggcccggccatcacgcgatgtggcccgtacccagctgacgctt
gatggacagaaactggattacttcaaccagatggaaagctggcagagcttcacctggccg
ggcaatacgtattatccgggagccgacctgagctggcgctcaaccagctctgaaatgcgt
ctctatgccagcaaccagggcaactggggctttattcgactgctcgacaaggcacagatc
accccgctcgacagcagccgcacccagctggtgtggatcaccccggacggcagcccgctg
aaatttatcatgcgcagcgagctcggcgacgggccgctggcgctgctcgaactgcagggc
ttcagcctgccgcagacgatttttaccgtgggtacagttgacagcacatccacgcttgcc
ggagacgaataa

DBGET integrated database retrieval system