KEGG   Shimwellia blattae: EBL_c12580Help
Entry
EBL_c12580        CDS       T02111                                 

Gene name
ackA
Definition
(GenBank) acetate/propionate kinase
  KO
K00925  acetate kinase [EC:2.7.2.1]
Organism
ebt  Shimwellia blattae
Pathway
ebt00430  Taurine and hypotaurine metabolism
ebt00620  Pyruvate metabolism
ebt00640  Propanoate metabolism
ebt00680  Methane metabolism
ebt01100  Metabolic pathways
ebt01120  Microbial metabolism in diverse environments
ebt01200  Carbon metabolism
Module
ebt_M00579  Phosphate acetyltransferase-acetate kinase pathway, acetyl-CoA => acetate
Brite
KEGG Orthology (KO) [BR:ebt00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    EBL_c12580 (ackA)
   00640 Propanoate metabolism
    EBL_c12580 (ackA)
  09102 Energy metabolism
   00680 Methane metabolism
    EBL_c12580 (ackA)
  09106 Metabolism of other amino acids
   00430 Taurine and hypotaurine metabolism
    EBL_c12580 (ackA)
Enzymes [BR:ebt01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.2  Phosphotransferases with a carboxy group as acceptor
    2.7.2.1  acetate kinase
     EBL_c12580 (ackA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Acetate_kinase BcrAD_BadFG
Motif
Other DBs
NCBI-ProteinID: AFJ46361
UniProt: I2B757
Position
complement(1295581..1296783)
Genome map
AA seq 400 aa AA seqDB search
MSSKLVLVLNCGSSSLKFAIIDAVNGDEYLSGLAECFHLPEARIKWKLDGNKHEAALGGG
AAHSEALNFIVNTILAQKPELSAQLTAIGHRIVHGGEKYTSSVVIDESVIQGIKDAASFA
PLHNPAHLIGIAEAMKSFPNLKDKNVAVFDTAFHQTMPEESYLYALPYSLYKEHSIRRYG
AHGTSHFFVTQEAAKMLNKPVEELNIITCHLGNGGSVSAIRNGKCVDTSMGLTPLEGLVM
GTRSGDIDPAIVFHLHDTLGMSVDQINKMLTKESGLLGLTEVTSDCRYVEDNYREKEDAK
RAMDVYCHRLAKYIGAYTALMDGRLDGVVFTGGIGENAAMVRELSLGRLGVLGFEVDHER
NLAARFGKSGFINKEGTTLAMVIPTNEELVIAQDASRLTA
NT seq 1203 nt NT seq  +upstreamnt  +downstreamnt
atgtcgagtaagttagtactggttctcaactgcggtagctcctcactgaaattcgcaatt
atcgatgctgtaaacggtgacgaatacctgtctggtttagctgaatgtttccatcttcct
gaagcccgcatcaagtggaaattagacggtaacaaacacgaagctgccctgggtggcggt
gccgctcacagtgaagcactgaactttatcgttaacaccattctggctcagaaacctgaa
ctgtctgcgcagctgaccgctatcggtcaccgcatcgttcacggtggtgagaaatacacc
agctctgtggtgattgacgagtctgttatccagggtatcaaagatgcagcctcttttgca
ccgctgcacaacccggctcacctgatcggtatcgcagaagcgatgaaatctttcccgaat
ctgaaagacaaaaacgtggctgtattcgataccgcgttccaccagaccatgccggaagaa
tcttacctgtatgcgctgccgtacagcctgtacaaagagcacagcatccgtcgctatggc
gcacacggcaccagccacttcttcgtgactcaggaagcggccaaaatgctgaacaaaccg
gttgaagagctgaacatcatcacctgccacctgggcaacggtggttctgtttccgctatc
cgcaacggtaagtgcgttgacacctctatgggtctgaccccgctggaaggcctggtgatg
ggtacccgttctggtgatatcgatccggctatcgtcttccacctgcacgacactctgggc
atgagcgttgatcagatcaacaaaatgctgaccaaagagtctggcctgctgggtctgacc
gaagtcaccagcgactgccgctatgttgaagacaactaccgcgaaaaagaagacgccaaa
cgcgccatggacgtgtactgccaccgtctggctaaatacatcggcgcttacaccgcgctg
atggatggccgcctggatggcgtggtcttcaccggtggtatcggtgaaaacgcagccatg
gttcgcgaactgtccctgggccgcctgggcgtgctgggctttgaagttgatcacgaacgt
aacctggctgcccgtttcggcaaatccggtttcatcaacaaagaaggcaccaccctcgcg
atggttatcccgaccaacgaagaactggttatcgctcaggatgcttcccgcctgactgcc
tga

DBGET integrated database retrieval system