KEGG   Shimwellia blattae: EBL_c27270Help
Entry
EBL_c27270        CDS       T02111                                 

Gene name
phpB
Definition
(GenBank) alpha-ribazole-5'-phosphate phosphatase
  KO
K02226  alpha-ribazole phosphatase [EC:3.1.3.73]
Organism
ebt  Shimwellia blattae
Pathway
ebt00860  Porphyrin and chlorophyll metabolism
ebt01100  Metabolic pathways
Module
ebt_M00122  Cobalamin biosynthesis, cobinamide => cobalamin
Brite
KEGG Orthology (KO) [BR:ebt00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    EBL_c27270 (phpB)
Enzymes [BR:ebt01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.73  adenosylcobalamin/alpha-ribazole phosphatase
     EBL_c27270 (phpB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: His_Phos_1 Exonuc_X-T_C
Motif
Other DBs
NCBI-ProteinID: AFJ47798
UniProt: I2BB94
Position
2804799..2805419
Genome map
AA seq 206 aa AA seqDB search
MNLWFIRHGETEANLAGLYSGISETPLTARGERQACALQQMLAAVPFDRVLSSELTRAGH
TARLALAGRDLTMQTDNRLNEMNFGAWEMRHHRELHAEGSAEYRAWCQDWQTAVPPGGEG
FAAFSQRIRALADSLQADSQQARYQNVLLISHKGVLSLLLTHLLALPPEQMWRFDIAQGC
WSRVELLGDYAVLRSLNNQSVWVPAP
NT seq 621 nt NT seq  +upstreamnt  +downstreamnt
atgaatctctggtttatccgccacggtgaaaccgaagccaacctcgccggtttatatagc
ggcatcagcgaaacgccgctgaccgccagaggggagcgccaggcctgcgccttacagcag
atgctggccgccgtgccctttgaccgggtgctctccagcgagctgacccgcgccgggcac
acagcccggctggcgctggcggggcgggatcttaccatgcagaccgacaaccggctgaat
gaaatgaactttggtgcctgggagatgcgccaccaccgggaattacacgcggaaggcagc
gctgagtaccgggcctggtgccaggactggcaaaccgccgtacccccggggggcgaaggg
tttgcggcgttcagccagcgcatccgcgccctggcagacagcctgcaagccgacagccag
caggcccgataccagaacgtgttactgattagccacaaaggggtgctgagcctgctgctg
acccatttgctggcgctccccccggagcagatgtggcggtttgatattgcccaggggtgc
tggtcccgggtagagctgctgggggattatgcggttttacgctcattaaacaatcagagt
gtctgggtcccggccccctga

DBGET integrated database retrieval system