KEGG   Shimwellia blattae: EBL_c29490Help
Entry
EBL_c29490        CDS       T02111                                 

Gene name
hemB
Definition
(GenBank) delta-aminolevulinic acid dehydratase
  KO
K01698  porphobilinogen synthase [EC:4.2.1.24]
Organism
ebt  Shimwellia blattae
Pathway
ebt00860  Porphyrin and chlorophyll metabolism
ebt01100  Metabolic pathways
ebt01110  Biosynthesis of secondary metabolites
ebt01120  Microbial metabolism in diverse environments
Module
ebt_M00121  Heme biosynthesis, glutamate => heme
ebt_M00846  Siroheme biosynthesis, glutamate => siroheme
Brite
KEGG Orthology (KO) [BR:ebt00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    EBL_c29490 (hemB)
Enzymes [BR:ebt01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.24  porphobilinogen synthase
     EBL_c29490 (hemB)
Exosome [BR:ebt04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   EBL_c29490 (hemB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ALAD ComA
Motif
Other DBs
NCBI-ProteinID: AFJ48019
UniProt: I2BBW5
Position
3037306..3038286
Genome map
AA seq 326 aa AA seqDB search
MSDFSLINRPRRLRKSAAMRALFEETNLTLNDLALPIFVEEGLDEYKPVEAMPGVMRIPE
KHLAREIERIARAGVRAVMTFGISHHLDATGSDTWNENGLVARMSRICKETVPEMIVMSD
TCFCEYTSHGHCGVLCDHGVDNDRTLENLGKQAVVAARAGADFIAPSAAMDGQVQAIRQA
LDAAGFTDTAIMSYSTKFASSYYGPFREAAGTALKGDRKTYQMNPMNRREAIRESLLDEA
QGADCLMVKPAGAYLDVLRELRGRTELPLAAYQVSGEYAMIKFAALAGAINEENVVLESL
GSIKRAGADLIFSYFALDLAEKNILS
NT seq 981 nt NT seq  +upstreamnt  +downstreamnt
atgtcagatttttcacttattaatcgtccacgtcgcctgcgtaaatctgccgctatgcgc
gcgctctttgaagaaaccaacctgacccttaacgatctggcgctgcccattttcgttgaa
gaagggctggatgagtacaaacccgtcgaggccatgccaggcgtgatgcgtattccggaa
aaacaccttgcccgggaaattgaacgtatcgcccgggccggggtgcgtgccgtgatgacc
ttcggtatctctcaccatctggatgccaccggcagcgacacctggaacgagaacggcctg
gtggcccgcatgtcccgcatctgcaaagagaccgtaccggaaatgatagtcatgtccgat
acctgtttttgcgagtacaccagccacggccactgtggtgtgctgtgcgaccacggggta
gataacgaccgcacgctggaaaaccttggtaagcaggcggtggtcgccgcccgcgccggg
gccgattttattgccccgtcagcggcaatggacggccaggtccaggctatccgccaggcg
ctggatgcggccggttttaccgataccgctatcatgtcctactccactaagtttgcctcc
tcttattatggtccgttccgcgaagccgccgggaccgccctgaagggagatcgtaaaacc
taccagatgaacccgatgaaccgccgtgaggcgatccgcgaatccctgctggatgaagcc
cagggcgcagactgcctgatggtgaaaccggcgggcgcgtatctggatgtgctgcgtgag
ctgcgcggacgcaccgagctgcccctggcggcttatcaggtcagtggtgaatacgcgatg
atcaaattcgcggccctggcgggcgccattaacgaagagaacgtggtgctggaaagcctg
ggatcgattaagcgggcaggggctgatcttatcttcagttacttcgcgcttgatttagcg
gagaaaaatatcctctcctga

DBGET integrated database retrieval system