KEGG   Shimwellia blattae: EBL_c33450Help
Entry
EBL_c33450        CDS       T02111                                 

Gene name
thrC
Definition
(GenBank) threonine synthase
  KO
K01733  threonine synthase [EC:4.2.3.1]
Organism
ebt  Shimwellia blattae
Pathway
ebt00260  Glycine, serine and threonine metabolism
ebt00750  Vitamin B6 metabolism
ebt01100  Metabolic pathways
ebt01110  Biosynthesis of secondary metabolites
ebt01120  Microbial metabolism in diverse environments
ebt01230  Biosynthesis of amino acids
Module
ebt_M00018  Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:ebt00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    EBL_c33450 (thrC)
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    EBL_c33450 (thrC)
Enzymes [BR:ebt01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     EBL_c33450 (thrC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PALP Thr_synth_N
Motif
Other DBs
NCBI-ProteinID: AFJ48408
UniProt: I2BD04
Position
complement(3456631..3457917)
Genome map
AA seq 428 aa AA seqDB search
MKLYNLKDHNEQVSFAQAVTQGLGTQQGLFFPHELPEFELSAIDEMLNDDFVTRSAKILS
AFIGDEIPQSELASRVRAAFAFPAPVAKVSDSIGCLELFHGPTLAFKDFGGRFMAQMLDY
ISGDKPVTILTATSGDTGAAVAHAFYGMKNVRVVILYPRGKISPLQEKLFCTLGGNIETV
AIDGDFDACQALVKQAFDDEELKQALGLNSANSINISRLLAQICYYFEAVAQLPQEARNQ
LVISVPSGNFGDLTAGLLAKSLGLPVKRFIAATNANDTVPRFLATGEWAPHATRATLSNA
MDVSQPNNWPRVEELFRRKIWRLNELGSATVDDETTKEAMRELNRQGYVSEPHAAIAWHA
LNGQLEPGEYGLFLGTAHPAKFKESVEEILGQPLTLPQALAERADLPLLSHQLAADFAGL
RAFLLANR
NT seq 1287 nt NT seq  +upstreamnt  +downstreamnt
atgaaactctacaatctgaaagatcataacgaacaggtcagttttgctcaggcggtgacg
caggggctggggacacagcaggggctctttttccctcatgagctgccggagtttgaactc
tcggcaatcgacgagatgcttaacgacgatttcgtcacccgcagcgcgaaaattctcagc
gcattcattggcgatgagatcccgcaaagtgagctggcgtcccgggtgcgggccgcattt
gcgtttccggcgccggtggcgaaggtttcagacagcatcggctgcctggagctgtttcac
ggcccgaccctggcatttaaagattttggcggccgctttatggctcagatgctggactat
atcagcggcgacaagccggtaactatcctgacggccacctccggggatacgggggctgcg
gttgcgcatgcgttttacggtatgaaaaacgtgcgcgtggtgattctctacccccgtggc
aagataagcccgctgcaggaaaaactgttctgtaccctgggcggaaatattgaaaccgtc
gccattgatggcgattttgatgcctgccaggcgctggtaaaacaggcatttgatgacgaa
gagctgaaacaggcgctggggctcaactcagcaaactctatcaatatcagccgtctgctg
gcgcagatttgctattactttgaagctgtcgcccagttaccccaggaggcgcgtaaccag
ctggttatctctgttcccagcggtaacttcggggatctgaccgccggtttgctggcaaaa
tcccttggcctgccggtgaagcgctttattgcagccacgaatgccaacgatacagtaccg
cgctttttagccaccggtgagtgggcaccccacgcgacccgggccaccttgtccaacgcc
atggatgtcagccagcccaataactggccccgggttgaagagctgttccgtcgtaagatc
tggcgcctgaatgagctgggatccgctacggtggatgatgagaccaccaaagaggccatg
cgcgagctgaaccgccagggttatgtgtctgagccccatgcggccattgcctggcatgcc
ctgaacgggcaactggagcccggtgagtacgggctgttccttggtacggcgcacccggcg
aagtttaaagaaagcgttgaggagatcctcggccagccgctgacgctgccgcaggcgctg
gcggagcgtgctgacctgccgctgttgtcccatcagctggcggcagattttgccgggtta
cgtgctttcctgctggctaaccgctaa

DBGET integrated database retrieval system