KEGG   Enterobacteriaceae bacterium S05: CUC76_00750Help
Entry
CUC76_00750       CDS       T05725                                 

Definition
(GenBank) CoA transferase subunit B
  KO
K01029  3-oxoacid CoA-transferase subunit B [EC:2.8.3.5]
Organism
ebu  Enterobacteriaceae bacterium S05
Pathway
ebu00072  Synthesis and degradation of ketone bodies
ebu00280  Valine, leucine and isoleucine degradation
ebu00650  Butanoate metabolism
ebu01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ebu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    CUC76_00750
  09103 Lipid metabolism
   00072 Synthesis and degradation of ketone bodies
    CUC76_00750
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    CUC76_00750
Enzymes [BR:ebu01000]
 2. Transferases
  2.8  Transferring sulfur-containing groups
   2.8.3  CoA-transferases
    2.8.3.5  3-oxoacid CoA-transferase
     CUC76_00750
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CoA_trans AcetylCoA_hyd_C
Motif
Other DBs
NCBI-ProteinID: AWB60254
UniProt: A0A2S0V7T1
Position
complement(147335..147991)
Genome map
AA seq 218 aa AA seqDB search
MLTREQMAMRVAQELRDGDYVNLGIGIPTLVANYIPAGIEVMLQSENGLLGMGEFPDEQT
LDADMINAGKQTVTAQTGAAIFDSAQSFAMIRGGHVDLTVLGAFEVDVAGNIASWMIPGK
MVKGMGGAMDLVAGAQNIIVVMTHASKNGESKLLPQCTLPLTGVGCIRRVLTDLALLDIV
DGAFVLREVAPGVSPDEVMRKTAGRLIVAEDVREMRFS
NT seq 657 nt NT seq  +upstreamnt  +downstreamnt
atgttaacccgcgaacaaatggcgatgcgcgtcgcccaggagctgcgcgacggcgactac
gtcaacctcgggatcggtatcccgacgctggtggccaattacattcccgccggcattgaa
gtgatgctccagtcggagaacggcctgctggggatgggcgagtttcccgatgagcaaact
ctcgacgccgacatgatcaacgccggcaaacagaccgtcaccgcgcaaaccggggcggcg
atcttcgattcggcccagtcgttcgccatgatccgcggcggccacgtcgatcttacggtt
cttggcgcctttgaggtcgacgtcgcagggaatatcgcctcgtggatgatccctggaaaa
atggtcaaggggatgggcggcgccatggacctggtggccggcgcgcagaacatcatcgtg
gtgatgacccacgcctcaaagaacggcgaatccaaactgctgccgcagtgcaccctgccg
ctcaccggcgtgggctgcattcgccgggtgctcaccgacctggccctgctggacattgtc
gacggggcgtttgtcctgcgcgaagtggccccgggggtcagccccgacgaagtgatgcgt
aaaacggcgggacggctgatcgtcgccgaagacgtgcgcgaaatgcgcttcagctaa

DBGET integrated database retrieval system