KEGG   Enterobacteriaceae bacterium S05: CUC76_02295Help
Entry
CUC76_02295       CDS       T05725                                 

Definition
(GenBank) gamma-glutamyltransferase
  KO
K22602  oxamate amidohydrolase [EC:3.5.1.126]
Organism
ebu  Enterobacteriaceae bacterium S05
Pathway
ebu00230  Purine metabolism
ebu01100  Metabolic pathways
ebu01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:ebu00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    CUC76_02295
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:ebu01002]
    CUC76_02295
Enzymes [BR:ebu01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.126  oxamate amidohydrolase
     CUC76_02295
Peptidases and inhibitors [BR:ebu01002]
 Threonine peptidases
  Family T3: gamma-glutamyltransferase family
   CUC76_02295
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: G_glu_transpept
Motif
Other DBs
NCBI-ProteinID: AWB60536
UniProt: A0A2S0V8K6
Position
complement(446951..448537)
Genome map
AA seq 528 aa AA seqDB search
MHSSNVSTHGMAVAPHHLASQSALAILREGGSAIEAMVAAAAAIAVVYPHMNGLGGDGFW
LIVPPEGDPIAIDASGAAGSLATLEAYAGQRHIPHRGPQAALTVAGTVSGWDEALRISRD
LTGRALPVARLLADAIGYAEDGIPVTASQAHATASKLEELRHQPGFSETWLVAGEAPRPG
SRFRQPALAGTLRMLASDGLDSFYRGPLAERLAQGMAALGMPVTLGDLQAHRARRPAPLT
LQHQQGTLWNLAPPTQGLVSLAILGITDRLKMADADEAQTVHRIVEATKRAFALRDAHIT
DPRHLDVDVQALLTPEALQPLADSIDDASASPWGGGKGPGDTVWMGVVDNSGLAVSFIQS
IYHEFGSGVVIPDTGIVWQNRGAAFSLDPQHLLALAPGKQPFHTLNPAAARLNDGRVMVY
GSMGGDGQPQTQAALFTRYILQGAPLQESISRPRWLLGRTWGQSSDSLKLEGRFAPACIA
RLRDLGHEVEVLADFSEAMGHAGAIVRHPNGLLEGATDPRSNGAAAGY
NT seq 1587 nt NT seq  +upstreamnt  +downstreamnt
atgcacagtagcaacgtttcgacccacggcatggcggtcgctccccaccacctcgccagc
cagagcgcgctggccatcctgcgcgagggcggcagcgccattgaagcgatggtggctgcc
gcggcggccatcgccgtcgtctatcctcatatgaatggcctcggcggcgatggtttctgg
ctgatcgtgccgcctgagggagaccccatcgccattgacgccagcggtgccgccgggtcg
ctggcgaccctcgaggcctatgccggccagcgacatatcccccaccgggggccgcaggcc
gcgctgaccgtcgccggcaccgttagcggctgggacgaggcgctgcgtatttctcgggac
ttaaccggccgcgcgctgccggtggcgcgcctgctggccgatgcgatcggttatgccgaa
gacggcattccggtcaccgcctcgcaggcccacgccaccgccagcaaactggaagagctg
cgccatcagccgggcttcagcgaaacctggctggtcgcgggcgaggccccgcggcccggc
agccgcttccgccagcccgccctcgccggtaccctgcgcatgctggccagcgacggtctc
gacagtttctatcgcggtccgctggctgaacgtctcgcccaggggatggccgcgctgggg
atgcctgtcacactcggcgacctgcaggcccaccgcgcccggcgtccggcgccgctgacg
ctccagcaccagcagggaacgctgtggaacctcgccccacccacgcaggggctggtgtcg
ctggcgatccttggcattaccgaccgtctgaagatggccgacgccgacgaggcgcaaacg
gtgcaccgtatcgtcgaagccaccaagcgggcgtttgccctgcgcgatgcgcatatcacc
gatccgcgccatctggatgtggatgttcaggcgttgctcaccccggaagccctgcagccg
ctggccgacagcatcgacgacgccagcgcttctccctggggcggcggcaaaggaccgggc
gataccgtctggatgggcgtcgtggataacagcgggctggcggtgtcattcattcagagc
atctatcacgagtttggcagcggcgtggtgatcccggacaccgggatcgtctggcaaaac
cgcggggcggccttcagcctcgatccgcagcatctcctggcgctggcccctggcaaacag
ccgttccataccctcaaccccgccgcggcgcgcctgaacgatggccgggtgatggtctat
ggctcgatgggcggcgacggtcagccgcagacccaggccgcgctgtttacccgctatatc
ctgcagggggcgccgctgcaggagagcatctcccgtccgcgctggctgctgggccgcacc
tggggccagtcctcggattcactgaagctggagggacgctttgcccccgcctgcatcgcg
cgtctgcgcgatctggggcacgaggtggaagtgctggccgatttcagcgaggcgatgggc
cacgccggggccattgtccgccatcccaatggcctgcttgaaggggctaccgatccacgc
agcaacggcgccgccgccggatactaa

DBGET integrated database retrieval system