KEGG   Enterobacteriaceae bacterium S05: CUC76_12000Help
Entry
CUC76_12000       CDS       T05725                                 

Definition
(GenBank) aldehyde dehydrogenase (NADP(+))
  KO
K13877  2,5-dioxopentanoate dehydrogenase [EC:1.2.1.26]
Organism
ebu  Enterobacteriaceae bacterium S05
Pathway
ebu00040  Pentose and glucuronate interconversions
ebu00053  Ascorbate and aldarate metabolism
ebu01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ebu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    CUC76_12000
   00053 Ascorbate and aldarate metabolism
    CUC76_12000
Enzymes [BR:ebu01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.26  2,5-dioxovalerate dehydrogenase
     CUC76_12000
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh DDR
Motif
Other DBs
NCBI-ProteinID: AWB62262
UniProt: A0A2S0VDM5
Position
complement(2413910..2415514)
Genome map
AA seq 534 aa AA seqDB search
MNASQTMAGRQFIAGRRVASGEATLLSLRAVDGEATGHRFYPASREEAAQAAEAAQQAFA
VYSQTTPQQRARFLCAIADELDALGEAFFALAEQETALPLARLQGERARTSGQLRMFAGV
IQRGDTFAARIDTALADRQPLPRPDLRQYQQALGPVAVFGASNFPLAFSTAGGDTASALA
AGCPVVVKAHPGHMATAELTAEAIVRAVARCGLPGGVFNMIFGTDIGAELVRHPAIQAVG
FTGSLAGGKALYQMAQQRSQPIPLFAEMSAINPLIILPQALQTRAEALANELVASFTLGG
GQFCTRPGLILALRGAGLERFKSALCAAVAGSAPQVLLNTPTLQHYRQGVAALAAHPRIE
RLASGLAAGAGQAQTQLWQAQVEDLLAQDTLLQTEVFGPLSLLVEVDDAVQLQAVVKALQ
GQLTATLHAEADDGPLAANLLPLLCEKAGRVLFNGYPTGVEVCDAMVHGGPWPATTDARG
TSVGSRAIERFLRPVCLQNAPAALLPPALQDANPLNLLRLVNGQWTREAISSSH
NT seq 1605 nt NT seq  +upstreamnt  +downstreamnt
atgaatgcatctcagaccatggcgggacggcagtttattgccggccgccgcgttgccagc
ggcgaggcgacgctattgagcctgcgggcggtggatggggaagccaccggccatcgcttt
tatccggcttcacgcgaggaagccgcccaggccgcggaggcggcacagcaggcgtttgcc
gtttattcacaaaccacgccgcagcagcgggcgcgctttctctgcgccattgccgatgag
ctggacgcgctgggggaagcgttttttgcactcgccgaacaggagaccgcgctgccgctg
gcgcggctgcagggcgagcgggcgcgcaccagcggccagctgcggatgtttgctggcgtg
atccagcgcggggataccttcgccgctcgtattgataccgccttagccgaccgtcaaccg
ctgccgcgcccggacctgcgccagtatcagcaggcgttagggccggtggcggtgtttggc
gccagcaactttccgctggccttttccaccgctggcggcgataccgcctcggcgctggcg
gcgggctgcccggtggtggtgaaggcccatccgggccatatggccaccgccgagctgacc
gctgaagcgatcgtccgggcggtcgcgcgatgcgggttacccggcggcgtcttcaatatg
attttcgggactgatatcggcgccgaattagtccgccatccggcgattcaggccgttggc
tttaccggctcactggccggcggtaaggcgctgtatcaaatggcgcagcagcgttcgcag
ccaatcccgctgtttgctgaaatgtcggcgattaacccgctgattattctaccgcaggcg
ctgcagacgcgggccgaggcgctggcgaacgagctggtggcgtcattcaccctcggcggc
ggccagttctgtacccgtccggggctgattctggcgctgcgcggcgccgggctggaacgc
tttaagtcggcgctgtgcgcggcggtagcgggctctgcgccgcaggtgttgctcaatacg
ccgaccctccagcactaccgccagggcgtggcggccctggcggcgcacccgcgtatcgag
aggctggcgagcggcctcgccgccggcgccgggcaggcgcagacccagctgtggcaggct
caggtcgaagatctgctggcgcaggatacgctgctgcagaccgaagttttcggcccgcta
tcgttgctggtggaagtggacgacgcggtccagctacaggcggtggtgaaagcgctgcag
ggacagctcaccgcgacgctgcacgcggaagcggacgacggcccgctggcggccaacctg
ctaccgctgctgtgcgagaaggccggacgggtgctgtttaacggttatcccaccggcgtg
gaagtgtgcgatgcgatggtccacggcggcccgtggccggcgacgaccgatgcgcgcgga
acgtcggtcggcagccgggcgattgagcgttttctgcgcccggtctgcctgcagaatgcg
ccggccgccctgttaccgccggcgctgcaggatgcgaaccctttgaacctgctgcgcctg
gtcaacggccagtggacccgggaagcgatttcctcctctcattga

DBGET integrated database retrieval system