KEGG   Enterobacteriaceae bacterium S05: CUC76_15760Help
Entry
CUC76_15760       CDS       T05725                                 

Definition
(GenBank) signal transduction histidine-protein kinase/phosphatase UhpB
  KO
K07675  two-component system, NarL family, sensor histidine kinase UhpB [EC:2.7.13.3]
Organism
ebu  Enterobacteriaceae bacterium S05
Pathway
ebu02020  Two-component system
Brite
KEGG Orthology (KO) [BR:ebu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    CUC76_15760
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:ebu01001]
    CUC76_15760
  09183 Protein families: signaling and cellular processes
   02022 Two-component system [BR:ebu02022]
    CUC76_15760
Enzymes [BR:ebu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.13  Protein-histidine kinases
    2.7.13.3  histidine kinase
     CUC76_15760
Protein kinases [BR:ebu01001]
 Histidine kinases
  NarL family
   CUC76_15760
Two-component system [BR:ebu02022]
 NarL family
  UhpB-UhpA (hexose phosphates uptake)
   CUC76_15760
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HisKA_3 MASE1 HATPase_c
Motif
Other DBs
NCBI-ProteinID: AWB62925
UniProt: A0A2S0VFH4
Position
3161305..3162807
Genome map
AA seq 500 aa AA seqDB search
MKTILPRLLSVIGCAFIFAAAWFCLWSISLHLVERADLAVLLFPFGLRLGLMLQCPRGYW
PVLLGTEWLLIFWLAQEVALAHPIILMTGSLLTLLPVALISRYRQQRDWLTLLRQGGALM
AAALLQSLPWLAEGDEGLNALLLTLTGGLTLAPTCLVFWHYLTSTVWRPLGPSLVAQPVN
WRGRHLIWYLLLFTISLWLQLGLPAELSRFTPFCLALPIIALAWHYGWQGALIATLMNAI
ALIASQTWHDHPVDLLLSLLAQSLTGLLLGAGIQRLRELNQSLQNELARNRRLADRLLET
EESVRRDVARELHDDIGQTITAIRTQAGIVQRLAPDNASVRQSGQLIEHLSLGVYDSVRR
LLGRLRPRQLDDLPLEQAVRSLMREMELEDRGIVSHLDWRINEAGLSENQRVTLFRVCQE
GLNNIVKHASASAVTLQGWQQEERLMLVLEDDGCGLPPGSSAQGFGLTGMRERVTALGGT
LTISCTHGTRVCVNLPLRYA
NT seq 1503 nt NT seq  +upstreamnt  +downstreamnt
atgaagaccatactcccgcgcctgctgtcggtgatcggctgcgcctttattttcgccgcc
gcctggttttgtctgtggagcatcagcctgcatctggtggagcgcgccgatctggcggtg
ctgctgttccccttcggcctgcgtttggggctgatgctgcagtgcccgcgcggctactgg
ccggtgctgctgggaaccgagtggctgctgatcttctggctggcgcaggaagtagcgctg
gcgcacccgataatattgatgaccggaagcctgctgaccctcctgccggtggcgctgatc
tcgcgatatcgccagcagcgcgactggctgacgcttctgcgtcagggcggggcgttaatg
gccgccgcgctgctgcaatcgctgccctggctggcggagggggacgagggtcttaacgcc
ctgctgttgacgctcaccggcggcctgactctggcgccgacctgtctggtgttctggcac
tacctcaccagcaccgtctggcggcccctggggccgtcgctggtggcgcagccggtaaac
tggcgcgggcggcatctgatctggtatctgttgttattcaccattagcctgtggctgcag
cttgggctgcccgccgagctctcccgctttaccccgttttgccttgcgctgccgattatc
gccctcgcctggcactacggctggcagggcgcgctgatcgccacattgatgaacgctatc
gccctgattgccagccagacctggcacgatcaccccgtcgatctcctgctttcgctgctg
gcgcagagcctcaccggactgctgctgggggcggggatccagcgattgcgcgagcttaac
cagtcgctacagaacgagctggcgcgtaatcgtcgtctggcggatcgcctgctggagacc
gaagagagcgtgcgccgcgacgtcgcccgcgagctccatgatgatatcggccagaccatc
accgcaatacgcacccaggcggggatcgtccagcggctggcgccggacaacgccagcgtt
cgccagagcggccagctgattgaacacctctcgctgggggtttacgactcggtgcgtcgc
ctgctgggccgcctgcgtccgcgccagcttgacgacctgccgctggagcaggcggtacgt
tctctgatgcgcgagatggagctggaggaccgcggcattgtcagccatctcgactggcgg
attaacgaggcgggactgagcgaaaaccagcgcgtgaccctgttccgcgtctgccaggag
ggactgaacaatatcgtcaagcacgccagcgccagcgccgtgaccctgcagggctggcag
caggaggagcgactgatgctggtgctggaggatgacggctgcggcctgccgccgggctcc
agcgcgcagggattcggtctgaccggcatgcgcgagcgcgtgaccgccctggggggcacg
ctgacgatctcctgcacccacggtacccgggtgtgcgtcaatctaccgctgcgttacgcc
tga

DBGET integrated database retrieval system