KEGG   Enterobacteriaceae bacterium S05: CUC76_22825Help
Entry
CUC76_22825       CDS       T05725                                 

Definition
(GenBank) tRNA pseudouridine(38-40) synthase TruA
  KO
K06173  tRNA pseudouridine38-40 synthase [EC:5.4.99.12]
Organism
ebu  Enterobacteriaceae bacterium S05
Brite
KEGG Orthology (KO) [BR:ebu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:ebu03016]
    CUC76_22825
Enzymes [BR:ebu01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.99  Transferring other groups
    5.4.99.12  tRNA pseudouridine38-40 synthase
     CUC76_22825
Transfer RNA biogenesis [BR:ebu03016]
 Eukaryotic type
  tRNA modification factors
   Psudouridine synthases
    CUC76_22825
 Prokaryotic type
    CUC76_22825
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PseudoU_synth_1
Motif
Other DBs
NCBI-ProteinID: AWB64200
UniProt: A0A2S0VJB4
Position
4563120..4563932
Genome map
AA seq 270 aa AA seqDB search
MSEMEQQPVCKIALGIEYDGSKYYGWQRQNEVRSVQEKLEKALSQVANEPITVFCAGRTD
AGVHGTGQVVHFETRAQRKDAAWTLGVNANLPGDIAVRWVKHVPADFHARFSATARRYRY
VIYNHRLRPAVLSHGVTHFHQPLDAARMQRAAQCLLGENDFTSFRAVQCQSRTPWRNVMH
INVTRYGAYVVVDIKANAFVHHMVRNIVGSLMEIGAGNQPESWMAELLAAKDRTLAAATA
KAEGLYLVSVDYPAHYDLPVLPMGPLFLAD
NT seq 813 nt NT seq  +upstreamnt  +downstreamnt
atgtctgagatggagcaacagccggtctgtaaaatcgcgctgggcatcgagtacgacggt
agcaaatattacggctggcagcggcaaaacgaagtgcgcagcgtgcaggagaagctggaa
aaggcgctctcgcaggtggcgaacgaaccgattaccgtcttttgcgccggccgcaccgac
gccggtgtccatggcaccggccaggtggtgcatttcgaaacccgggcgcagcgtaaagat
gccgcctggacgctgggggtaaatgcgaatttacctggtgacatcgcggtgcgttgggtc
aaacatgtaccggcggattttcatgcccggttcagcgccacggcgcgccgctatcgttac
gtcatctataatcatcgcctgcgtccggcggtattgagtcatggcgtcacgcattttcac
cagccgctcgacgccgcgcgcatgcagcgcgccgcgcagtgtctgctgggggagaatgac
tttacctcgtttcgcgcagtgcagtgccagtcgcgaaccccgtggcgcaacgtgatgcac
attaacgttacccgttacggcgcttatgtggtggtggatatcaaagcgaatgcctttgta
catcatatggtcaggaatattgtgggcagcctgatggaaatcggggccggtaaccagccg
gagagctggatggcagaactgctggcagcaaaagacaggacgctcgctgcggcaacggca
aaagcggaagggttgtatctggtgtcggtggattacccggcccattatgatttaccggtg
ctgccaatgggcccgctgtttctggcggactaa

DBGET integrated database retrieval system