KEGG   Enterobacteriaceae bacterium S05: CUC76_22935Help
Entry
CUC76_22935       CDS       T05725                                 

Definition
(GenBank) acetate kinase
  KO
K00925  acetate kinase [EC:2.7.2.1]
Organism
ebu  Enterobacteriaceae bacterium S05
Pathway
ebu00430  Taurine and hypotaurine metabolism
ebu00620  Pyruvate metabolism
ebu00640  Propanoate metabolism
ebu00680  Methane metabolism
ebu01100  Metabolic pathways
ebu01120  Microbial metabolism in diverse environments
ebu01200  Carbon metabolism
Module
ebu_M00579  Phosphate acetyltransferase-acetate kinase pathway, acetyl-CoA => acetate
Brite
KEGG Orthology (KO) [BR:ebu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    CUC76_22935
   00640 Propanoate metabolism
    CUC76_22935
  09102 Energy metabolism
   00680 Methane metabolism
    CUC76_22935
  09106 Metabolism of other amino acids
   00430 Taurine and hypotaurine metabolism
    CUC76_22935
Enzymes [BR:ebu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.2  Phosphotransferases with a carboxy group as acceptor
    2.7.2.1  acetate kinase
     CUC76_22935
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Acetate_kinase BcrAD_BadFG
Motif
Other DBs
NCBI-ProteinID: AWB64221
UniProt: A0A2S0VJ45
Position
complement(4582247..4583449)
Genome map
AA seq 400 aa AA seqDB search
MSSKLVLVLNCGSSSLKFAILDAVNGDEYLSGLAECFHLPEARIKWKIDGGKQEAELGAG
AAHSEALNFIVNTILAQKPELSAQLTAIGHRIVHGGEKYTSSVVIDESVIQGIKDAASFA
PLHNPAHLIGIAEALKSFPHLKDKNVAVFDTAFHQTMPEESYLYALPYSLYKEHGVRRYG
AHGTSHFYVTQEAAKILNKPVEELNIITCHLGNGGSVSAIRNGKCVDTSMGLTPLEGLVM
GTRSGDIDPAIIFHLHDTLGMSVDAINKMLTKESGLLGLTEVTSDCRYVEDNYQEKADAK
RAMDVYCHRLAKYIGSYTALMDGRLDAVVFTGGIGENAAMVRELSLGKLGVLGFEVDHER
NLAARFGKSGFINKEGTRPAVVIPTNEELVIAQDASRLTA
NT seq 1203 nt NT seq  +upstreamnt  +downstreamnt
atgtcgagtaagttagtactggttctgaactgcggtagctcctctctgaaatttgctatc
cttgacgccgttaacggcgacgaatacctgtccggtttagcggaatgcttccacctgcca
gaagcccgtatcaaatggaaaattgacggcggcaaacaagaagccgaattaggcgcgggc
gccgcgcacagcgaagcactgaactttatcgttaacactattctggcacaaaaaccagaa
ctgtctgctcagctgaccgcaattggccaccgtatcgtccacggcggtgaaaaatacacc
agctccgtcgtcatcgacgagtccgtgattcagggcattaaagacgcggcgtcctttgca
ccgctgcacaacccggcacatctgatcggcatcgctgaagcgctgaaatccttcccgcac
ctgaaagacaaaaacgtggcagtattcgatacggcgttccaccaaaccatgccggaagaa
tcctatctctacgccctgccgtacagcctgtacaaagagcacggcgttcgtcgttacggc
gcacacggcaccagccacttctacgtgactcaggaagccgctaagatcctgaacaagccg
gttgaagagctgaacatcatcacctgccaccttggcaacggtggttcggtttccgctatt
cgtaacggcaaatgcgttgacacctccatgggtctgaccccgctggaaggcctggtgatg
ggtacccgctccggcgatatcgatccggcaatcatcttccatctgcacgacaccctgggc
atgagcgttgacgccatcaacaaaatgctgaccaaagagtccggcctgctgggcctgacc
gaagtcaccagcgactgccgctacgtggaagacaactaccaggaaaaagccgacgctaaa
cgcgcgatggacgtctactgccaccgcctggcgaaatacatcggctcctacaccgcgctg
atggacggccgtctcgacgccgtggtcttcaccggtggcattggtgaaaacgccgcgatg
gtgcgtgagctgtcgctgggcaaactgggcgtactgggcttcgaagttgaccatgagcgt
aacctggctgcccgcttcggcaagtctggcttcatcaacaaagaaggcacccgtcctgcc
gtggttatcccgaccaacgaagagctggtcatcgcgcaagacgccagccgtctgaccgca
taa

DBGET integrated database retrieval system