KEGG   Enterobacteriaceae bacterium S05: CUC76_23270Help
Entry
CUC76_23270       CDS       T05725                                 

Gene name
mqo
Definition
(GenBank) malate dehydrogenase (quinone)
  KO
K00116  malate dehydrogenase (quinone) [EC:1.1.5.4]
Organism
ebu  Enterobacteriaceae bacterium S05
Pathway
ebu00020  Citrate cycle (TCA cycle)
ebu00620  Pyruvate metabolism
ebu01100  Metabolic pathways
ebu01110  Biosynthesis of secondary metabolites
ebu01120  Microbial metabolism in diverse environments
ebu01200  Carbon metabolism
Module
ebu_M00009  Citrate cycle (TCA cycle, Krebs cycle)
ebu_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:ebu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    CUC76_23270 (mqo)
   00620 Pyruvate metabolism
    CUC76_23270 (mqo)
Enzymes [BR:ebu01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.4  malate dehydrogenase (quinone)
     CUC76_23270 (mqo)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Mqo DAO
Motif
Other DBs
NCBI-ProteinID: AWB64286
UniProt: A0A2S0VJA0
Position
4658554..4660188
Genome map
AA seq 544 aa AA seqDB search
MNKKMAVPRSQAVGPNSTRTNTRHEQETDVLLIGGGIMSATLGTWLQELEPDWSITMVEQ
MSSVAEESSNGWNNAGTGHAALMELNYTPQTANGINIDKAVDINEAFHISRQFWAHQVTR
GVLNKPKSFINSVPHMSFVWGEDNVNFLRARYAALQQSELFRGIRYSEDHQQIKAWAPLV
MEGRDPLQKVAATRTEMGTDVNYGEITRQLIASLQKHDNFSLQLGTVVRRFKRNADKSWT
VTLADADNRRQKRVIKAKFIFIGAGGAALTLLQETGIPQAKEYAGFPVGGQFLVCENPEV
VNHHLAKVYGQAEVGAPPMSVPHIDTRIIDGKRVVLFGPFATFSTRFLKNGSLWDLLAST
NTSNILPMLNVGLDNFDLVKYLISQVMQKDKDRLAALCEYYPEARKEDWRLWQAGQRVQI
IKRDAKKGGVLRLGTEVVSDDEGTVAALLGASPGASTAAPIMLQLMEKVFKDKVNSPEWQ
ARLKAIIPTYGIRLDGNPAEIEKALAWTSEVLELKYEPAAAADEAPQAELKPLSGGKPMA
DIAL
NT seq 1635 nt NT seq  +upstreamnt  +downstreamnt
atgaataaaaagatggccgtaccacgctcacaggcggttggtcccaacagcactcggacc
aacacccgccatgagcaagagacggatgtattgttgattggcggcggcattatgagcgcc
acactgggaacctggctgcaggagcttgagccagactggtctattaccatggttgagcag
atgtccagcgtggcggaagagagctcaaacgggtggaacaatgcgggtaccggccacgcg
gcgctgatggagctgaactatacgccgcagaccgccaacggcatcaatatcgacaaagcg
gtcgacatcaacgaagccttccacatctcgcgtcagttctgggcgcatcaggtgacgcgc
ggcgtcctgaacaaaccaaaatcattcattaacagcgtgccgcacatgagctttgtgtgg
ggcgaagataacgtcaacttcctgcgcgcgcgctatgcggcgctgcagcagagcgaactg
ttccgcggcattcgttattctgaagaccatcagcaaatcaaagcctgggcgccgctggtg
atggaaggccgcgacccgctgcaaaaggtggccgccacccgtacggaaatgggaaccgac
gtcaactatggcgaaatcacccgccagctgatcgccagcctgcaaaagcatgataatttc
tccctgcagctgggcaccgtggtgcgtcgcttcaagcgcaacgccgataagagctggacg
gtgaccctcgcggatgccgacaaccgtcgtcagaagcgggttattaaagccaaatttatc
tttatcggcgccggcggcgcggcgctgaccctgctgcaggaaaccggcattccgcaggcc
aaagagtatgccggcttcccggtcggcggccagttcctggtctgcgaaaatccggaggta
gtaaaccaccatctggcgaaggtttacggccaggccgaagtgggcgcgccgccgatgtca
gtgccgcacatcgatacccgtattatcgacggtaaacgcgtggtgctgttcgggccgttc
gccaccttctcgacccgcttcctgaagaacggttcgctgtgggatctgctggcctcgacc
aatacctcgaatatcctgccgatgctcaacgtcggcctggacaacttcgatctggtgaaa
tacctgattagccaggtgatgcagaaagataaagatcgtctggccgcgctgtgcgaatac
tatccggaagcgcggaaagaggactggcggttgtggcaggccggtcagcgcgtgcagatc
atcaagcgcgatgcgaagaagggcggggtactgcgcctgggcaccgaagtggtcagcgat
gacgaaggcaccgtcgcggcgctgctcggcgcatcgccaggcgcctccaccgcggcgcct
atcatgctgcagctgatggaaaaagtgtttaaagacaaagtgaattcgcccgaatggcag
gccaggctgaaggcgatcatcccgacctacggtattcgccttgatggcaacccggcggag
attgagaaagcgctggcgtggaccagtgaagtgctggagctgaaatatgagccggccgcg
gcggcggatgaagctccgcaggcggagctgaagccgctgagcggcggcaagccgatggcg
gacatcgcgctctga

DBGET integrated database retrieval system