KEGG   Escherichia coli BW2952: BWG_0501Help
Entry
BWG_0501          CDS       T00913                                 

Gene name
lipB
Definition
(GenBank) lipoyl-protein ligase
  KO
K03801  lipoyl(octanoyl) transferase [EC:2.3.1.181]
Organism
ebw  Escherichia coli BW2952
Pathway
ebw00785  Lipoic acid metabolism
ebw01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ebw00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00785 Lipoic acid metabolism
    BWG_0501 (lipB)
Enzymes [BR:ebw01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.181  lipoyl(octanoyl) transferase
     BWG_0501 (lipB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: BPL_LplA_LipB
Motif
Other DBs
NCBI-ProteinID: ACR63668
UniProt: C4ZWB7
Position
complement(563620..564261)
Genome map
AA seq 213 aa AA seqDB search
MYQDKILVRQLGLQPYEPISQAMHEFTDTRDDSTLDEIWLVEHYPVFTQGQAGKAEHILM
PGDIPVIQSDRGGQVTYHGPGQQVMYVLLNLKRRKLGVRELVTLLEQTVVNTLAELGIEA
HPRADAPGVYVGEKKICSLGLRIRRGCSFHGLALNVNMDLSPFLRINPCGYAGMEMAKIS
QWKPEATTNNIAPRLLENILALLNNPDFEYITA
NT seq 642 nt NT seq  +upstreamnt  +downstreamnt
ttgtatcaggataaaattcttgtccgccagctcggtcttcagccttacgagccaatctcc
caggctatgcatgaattcaccgatacccgcgatgatagtacccttgatgaaatctggctg
gtcgagcactatccggtattcacccaaggtcaggcaggaaaagcggagcacattttaatg
ccgggtgatattccggtgatccagagcgatcgcggtgggcaggtgacttatcacgggccg
gggcaacaggtgatgtatgtgttgcttaacctgaaacgccgtaaactcggtgtgcgtgaa
ctggtgaccttgcttgagcaaacagtggtgaataccctggctgaactgggtatagaagcg
catcctcgggctgacgcgccaggtgtctatgttggggaaaagaaaatttgctcactgggt
ttacgtattcgacgcggttgttcattccacggtctggcattaaacgtcaatatggatctt
tcaccatttttacgtattaatccttgtgggtatgccggaatggaaatggctaaaatatca
caatggaaacccgaagcgacgactaataatattgctccacgtttactggaaaatatttta
gcgctactaaacaatccggacttcgaatatattaccgcttaa

DBGET integrated database retrieval system