KEGG   Escherichia coli BW2952: BWG_0509Help
Entry
BWG_0509          CDS       T00913                                 

Gene name
cobC
Definition
(GenBank) predicted alpha-ribazole-5'-P phosphatase
  KO
K02226  alpha-ribazole phosphatase [EC:3.1.3.73]
Organism
ebw  Escherichia coli BW2952
Pathway
ebw00860  Porphyrin and chlorophyll metabolism
ebw01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ebw00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    BWG_0509 (cobC)
Enzymes [BR:ebw01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.73  adenosylcobalamin/alpha-ribazole phosphatase
     BWG_0509 (cobC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: His_Phos_1 PPTA
Motif
Other DBs
NCBI-ProteinID: ACR64143
Structure
PDB: 

Position
complement(571279..571890)
Genome map
AA seq 203 aa AA seqDB search
MRLWLIRHGETQANIDGLYSGHAPTPLTARGIEQAQNLHTLLHGVSFDLVLCSELERAQH
TARLVLSDRQLPVQIIPELNEMFFGDWEMRHHRDLMQEDAENYSAWCNDWQHAIPTNGEG
FQAFSQRVERFIARLSEFQHYQNILVVSHQGVLSLLIARLIGMPAEAMWHFRVDQGCWSA
IDINQKFATLRVLNSRAIGVENA
NT seq 612 nt NT seq  +upstreamnt  +downstreamnt
atgcgactgtggttaattcgtcatggtgaaacgcaagcgaatatcgatggtctttacagc
ggtcatgcgcccacccccctgaccgcgcgcggtattgagcaagcgcaaaatctgcatacg
ctgctacatggtgtttcctttgatctggttttatgcagtgaactggaacgggcacagcat
accgcgcgactggttctcagtgaccgccagctccccgtgcaaatcatacctgaactcaac
gaaatgttttttggcgactgggagatgcgacatcatcgcgacctcatgcaagaagatgcc
gaaaactatagcgcgtggtgcaatgactggcagcatgcaatccccacgaacggtgaagga
tttcaggcattttcgcaacgtgtggaacgctttatcgcaaggcttagtgaatttcagcac
tatcagaatattttagtcgtcagccatcagggtgtactgagtctgttaatcgcccgttta
attggcatgcctgccgaagctatgtggcattttcgcgttgaccaggggtgttggagcgcc
attgatatcaaccaaaaattcgcgacgctacgcgtcctcaatagccgtgccatcggggtc
gagaatgcatga

DBGET integrated database retrieval system