KEGG   Escherichia coli BW2952: BWG_0705Help
Entry
BWG_0705          CDS       T00913                                 

Gene name
rimK
Definition
(GenBank) ribosomal protein S6 modification protein
  KO
K05844  ribosomal protein S6--L-glutamate ligase [EC:6.3.2.-]
Organism
ebw  Escherichia coli BW2952
Brite
KEGG Orthology (KO) [BR:ebw00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03009 Ribosome biogenesis [BR:ebw03009]
    BWG_0705 (rimK)
Enzymes [BR:ebw01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.-  
     BWG_0705 (rimK)
Ribosome biogenesis [BR:ebw03009]
 Prokaryotic Type
  ribosomal protein modification factors
   BWG_0705 (rimK)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: RimK Rimk_N GSH-S_ATP ATP-grasp_3 ATPgrasp_ST Dala_Dala_lig_C ATPgrasp_YheCD Arm-DNA-bind_3 GARS_A R2K_3
Motif
Other DBs
NCBI-ProteinID: ACR65482
UniProt: C4ZY24
Structure
PDB: 

Position
794158..795060
Genome map
AA seq 300 aa AA seqDB search
MKIAILSRDGTLYSCKRLREAAIQRGHLVEILDPLSCYMNINPAASSIHYKGRKLPHFDA
VIPRIGTAITFYGTAALRQFEMLGSYPLNESVAIARARDKLRSMQLLARQGIDLPVTGIA
HSPDDTSDLIDMVGGAPLVVKLVEGTQGIGVVLAETRQAAESVIDAFRGLNAHILVQEYI
KEAQGCDIRCLVVGDEVVAAIERRAKEGDFRSNLHRGGAASVASITPQEREIAIKAARTM
ALDVAGVDILRANRGPLVMEVNASPGLEGIEKTTGIDIAGKMIRWIERHATTEYCLKTGG
NT seq 903 nt NT seq  +upstreamnt  +downstreamnt
gtgaaaattgccatattgtcccgggatggaacgctctattcgtgtaagcggctgcgtgaa
gccgctatacagcgcggtcacctggttgaaattcttgatccgctttcttgctacatgaac
ataaatcctgcggcgtcttctattcactacaaaggccgcaagttaccccattttgacgca
gtgatcccgcgtattggcaccgccattaccttttatgggacggcggcactgcgccagttc
gagatgctggggagctatccgctcaatgagtcggtcgccattgcccgggcgcgtgacaaa
ttgcgttccatgcaactgctggcgcgtcagggcatcgacctgcctgtcacgggcattgcg
cattcgccggatgataccagcgatttaatcgacatggtcggtggtgcgccgctggtggtc
aagttggttgaaggcacgcagggaattggcgtcgtgctggcggagacgcgtcaggcggcg
gaaagcgtgattgacgctttccgcggtctgaacgcgcatattctggtgcaggaatatatc
aaagaggcgcaagggtgcgatatccgctgtctggttgttggcgatgaagtggtcgctgcg
attgaacggcgggcgaaagagggcgattttcgttccaatttgcatcgtggcggcgcggca
agcgtcgccagtatcacaccacaggagcgtgaaatcgcgataaaagccgcgcgaacgatg
gcgctggacgttgctggtgtggatattctgcgtgctaatcgcgggccgttggtgatggag
gtgaatgcgtcgccggggctggaaggaatagaaaaaaccaccggtatcgacatcgcgggt
aaaatgatccgctggatcgaacgccacgctacgacagaatattgcctgaaaacgggtggt
tag

DBGET integrated database retrieval system