KEGG   Escherichia coli BW2952: BWG_1024Help
Entry
BWG_1024          CDS       T00913                                 

Gene name
dhaL
Definition
(GenBank) dihydroxyacetone kinase, C-terminal domain protein
  KO
K05879  phosphoenolpyruvate---glycerone phosphotransferase subunit DhaL [EC:2.7.1.121]
Organism
ebw  Escherichia coli BW2952
Pathway
ebw00561  Glycerolipid metabolism
ebw01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ebw00001]
 09100 Metabolism
  09103 Lipid metabolism
   00561 Glycerolipid metabolism
    BWG_1024 (dhaL)
Enzymes [BR:ebw01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.121  phosphoenolpyruvate---glycerone phosphotransferase
     BWG_1024 (dhaL)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dak2
Motif
Other DBs
NCBI-ProteinID: ACR62766
Structure
PDB: 

Position
complement(1137069..1137701)
Genome map
AA seq 210 aa AA seqDB search
MSLSRTQIVNWLTRCGDIFSTESEYLTGLDREIGDADHGLNMNRGFSKVVEKLPAIADKD
IGFILKNTGMTLLSSVGGASGPLFGTFFIRAAQATQARQSLTLEELYQMFRDGADGVISR
GKAEPGDKTMCDVWVPVVESLRQSSEQNLSVPVALEAASSIAESAAQSTITMQARKGRAS
YLGERSIGHQDPGATSVMFMMQMLALAAKE
NT seq 633 nt NT seq  +upstreamnt  +downstreamnt
atgtcactgagcagaactcaaattgttaactggctcactcgttgtggcgatattttcagc
accgagagcgagtatcttaccggactggatcgcgaaattggcgatgctgaccacgggcta
aatatgaaccgaggctttagcaaagtggtggaaaaactccctgctatcgcagataaagat
atcggtttcattctcaagaataccggtatgacgctgctttccagcgtcggtggtgccagt
ggtccgctgttcggtaccttctttatccgcgccgcacaggcgacccaggcacggcaaagc
ctgacactggaagagctttatcagatgttccgcgatggcgcggacggcgtaatcagtcgc
gggaaagccgaacctggcgataaaaccatgtgtgatgtgtgggtgccggtggtggaatcg
ttacgtcagtccagcgagcaaaatctctctgttccggtggcgctcgaagctgccagtagc
atcgccgaatccgctgcacaaagtacgattacgatgcaagcccgcaaaggccgcgccagt
tatctcggtgaacgcagtattggtcaccaggatcccggcgcgacctcggtgatgtttatg
atgcaaatgttggcgttagccgcaaaagagtaa

DBGET integrated database retrieval system