KEGG   Escherichia coli K-12 BW2952: BWG_1649
Entry
BWG_1649          CDS       T00913                                 

Gene name
rsmF
Definition
(GenBank) predicted methyltransferase
  KO
K11392  16S rRNA (cytosine1407-C5)-methyltransferase [EC:2.1.1.178]
Organism
ebw  Escherichia coli K-12 BW2952
Brite
KEGG Orthology (KO) [BR:ebw00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03009 Ribosome biogenesis [BR:ebw03009]
    BWG_1649 (rsmF)
Enzymes [BR:ebw01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.178  16S rRNA (cytosine1407-C5)-methyltransferase
     BWG_1649 (rsmF)
Ribosome biogenesis [BR:ebw03009]
 Prokaryotic type
  rRNA modification factors
   16S rRNA modification factors
    BWG_1649 (rsmF)
SSDB
Motif
Pfam: Methyltr_RsmB-F Methyltr_RsmF_N Methyltranf_PUA Methyltransf_31 FtsJ PCMT TRM Ubie_methyltran
Other DBs
NCBI-ProteinID: ACR64666
UniProt: C4ZZJ2
Structure
PDB: 
2FRX

Position
1810306..1811745
AA seq 479 aa
MAQHTVYFPDAFLTQMREAMPSTLSFDDFLAACQRPLRRSIRVNTLKISVADFLQLTAPY
GWTLTPIPWCEEGFWIERDNEDALPLGSTAEHLSGLFYIQEASSMLPVAALFADGNAPQR
VMDVAAAPGSKTTQISARMNNEGAILANEFSASRVKVLHANISRCGISNVALTHFDGRVF
GAAVPEMFDAILLDAPCSGEGVVRKDPDALKNWSPESNQEIAATQRELIDSAFHALRPGG
TLVYSTCTLNQEENEAVCLWLKETYPDAVEFLPLGDLFPGANKALTEEGFLHVFPQIYDC
EGFFVARLRKTQAIPALPAPKYKVGNFPFSPVKDREAGQIRQAATGVGLNWDENLRLWQR
DKELWLFPVGIEALIGKVRFSRLGIKLAETHNKGYRWQHEAVIALASPDNMNAFELTPQE
AEEWYRGRDVYPQAAPVADDVLVTFQHQPIGLAKRIGSRLKNSYPRELVRDGKLFTGNA
NT seq 1440 nt   +upstreamnt  +downstreamnt
gtggcccaacacaccgtttatttcccggacgcctttctgacacaaatgcgcgaagcgatg
ccttcgacgctctcatttgatgattttcttgccgcctgtcagcgcccgttgcgccgcagc
attcgcgttaatacgctgaaaatctccgttgctgatttcctgcaattaaccgctccttat
ggctggacgcttacgccaattccgtggtgtgaagaaggtttctggattgaacgcgacaat
gaagatgcattgccattgggtagtaccgccgagcatttaagtggcctgttttatattcag
gaagccagttcaatgttgcctgttgccgccttgtttgctgacggtaatgcaccacagcgg
gtgatggatgtcgctgccgcgcctggctccaaaacgacgcaaatttccgcgcggatgaat
aacgaaggggcaatccttgccaatgagttttccgccagtcgggtaaaagtgttacatgcc
aatatcagccgctgtggtatcagtaatgttgcgctcacacattttgatggccgcgtgttt
ggtgcggcagtgccagaaatgttcgatgccattttgctggacgctccctgctctggcgaa
ggcgtggtgcgtaaagatcccgatgcgctaaaaaactggtcaccagaaagcaatcaggaa
atcgcagctacacaacgggagcttatcgacagcgcctttcatgcattacgtcctggtggt
acgctggtttactcgacctgtaccttaaaccaggaagaaaacgaagccgtttgcctgtgg
ctgaaagagacttaccccgacgcagtagagtttttaccacttggcgatctcttccctggt
gcaaacaaagcgctgaccgaagaaggctttttgcatgttttcccacaaatttacgactgc
gaaggcttcttcgttgctcgtctgcgtaaaactcaggcgattcccgccttacccgccccc
aaatacaaagtcggtaattttccgttcagcccggtgaaagatcgcgaagctggacaaatt
cgtcaggcggctacaggtgttggcttaaactgggatgaaaacctgcgcctctggcagcgt
gacaaagaactgtggttgttcccggtgggcattgaagccctgatcggtaaagtccgattt
tctcggttggggattaaacttgccgagacgcacaacaaaggttatcgctggcagcatgaa
gcggttattgctcttgcctcacccgataatatgaatgcattcgagctgacaccgcaggaa
gcggaggagtggtatcgcgggcgcgatgtttacccgcaagccgcgccagtggcggatgat
gtattggttactttccagcatcaaccgattggtttagccaaacggattggttcgcgattg
aaaaacagctatccgcgtgaactggtgcgcgatgggaaactttttaccggtaacgcctga

DBGET integrated database retrieval system