KEGG   Escherichia coli BW2952: BWG_2037Help
Entry
BWG_2037          CDS       T00913                                 

Gene name
yfbB
Definition
(GenBank) predicted peptidase
  KO
K08680  2-succinyl-6-hydroxy-2,4-cyclohexadiene-1-carboxylate synthase [EC:4.2.99.20]
Organism
ebw  Escherichia coli BW2952
Pathway
ebw00130  Ubiquinone and other terpenoid-quinone biosynthesis
ebw01100  Metabolic pathways
ebw01110  Biosynthesis of secondary metabolites
Module
ebw_M00116  Menaquinone biosynthesis, chorismate => menaquinol
Brite
KEGG Orthology (KO) [BR:ebw00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00130 Ubiquinone and other terpenoid-quinone biosynthesis
    BWG_2037 (yfbB)
Enzymes [BR:ebw01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.99  Other carbon-oxygen lyases
    4.2.99.20  2-succinyl-6-hydroxy-2,4-cyclohexadiene-1-carboxylate synthase
     BWG_2037 (yfbB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Abhydrolase_6 Abhydrolase_1 Hydrolase_4 Thioesterase Lipase_3
Motif
Other DBs
NCBI-ProteinID: ACR64782
UniProt: C4ZUA6
Structure
PDB: 

Position
complement(2260661..2261419)
Genome map
AA seq 252 aa AA seqDB search
MILHAQAKHGKPGLPWLVFLHGFSGDCHEWQEVGEAFADYSRLYVDLPGHGGSAAISVDG
FDDVTDLLRKTLVSYNILDFWLVGYSLGGRVAMMAACQGLAGLCGVIVEGGHPGLQNAEQ
RAERQRSDRQWVQRFLTEPLTAVFADWYQQPVFASLNDDQRRELVALRSNNNGATLAAML
EATSLAVQPDLRANLSARTFAFYYLCGERDSKFRALAAELAADCHVIPRAGHNAHRENPA
GVIASLAQILRF
NT seq 759 nt NT seq  +upstreamnt  +downstreamnt
atgatcctgcacgcgcaggcaaaacacggaaaaccaggtttaccctggctggtgtttttg
cacggtttttccggcgattgccacgaatggcaagaagtgggcgaggcgtttgccgactac
tcacggttgtatgttgatctcccaggtcacggtggttcggcggcgattagcgtcgatgga
tttgatgatgtcaccgacttactgcgtaaaaccttggttagttacaacatccttgacttc
tggctggtggggtactcgcttggtggacgggtggcgatgatggcggcttgccaggggctg
gcggggctttgtggggttattgtcgaaggcgggcatccggggctgcaaaatgctgaacaa
cgtgcggaacgtcagcgttccgatcgccaatgggtgcagcgttttctcacagaaccgtta
acggcggtatttgccgactggtatcaacagcctgtttttgcctcactcaatgacgatcaa
cgccgggagctggtggcgctgcgcagcaacaataatggcgcaacgcttgccgccatgctg
gaggcgacttctctcgccgtccagcctgatttacgtgctaaccttagcgcccgcacattt
gcgttttattatttatgtggtgaacgtgacagcaaattccgcgccctggcggcggaactg
gctgccgactgccatgtcattcctcgcgccggacataacgcgcatcgggaaaatcccgct
ggcgtaatcgcaagtctggcgcagatcttgcgtttctga

DBGET integrated database retrieval system