KEGG   Escherichia coli K-12 BW2952: BWG_2038
Entry
BWG_2038          CDS       T00913                                 

Gene name
menD
Definition
(GenBank) bifunctional 2-oxoglutarate decarboxylase/SHCHC synthase
  KO
K02551  2-succinyl-5-enolpyruvyl-6-hydroxy-3-cyclohexene-1-carboxylate synthase [EC:2.2.1.9]
Organism
ebw  Escherichia coli K-12 BW2952
Pathway
ebw00130  Ubiquinone and other terpenoid-quinone biosynthesis
ebw01100  Metabolic pathways
ebw01110  Biosynthesis of secondary metabolites
ebw01240  Biosynthesis of cofactors
Module
ebw_M00116  Menaquinone biosynthesis, chorismate (+ polyprenyl-PP) => menaquinol
Brite
KEGG Orthology (KO) [BR:ebw00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00130 Ubiquinone and other terpenoid-quinone biosynthesis
    BWG_2038 (menD)
Enzymes [BR:ebw01000]
 2. Transferases
  2.2  Transferring aldehyde or ketonic groups
   2.2.1  Transketolases and transaldolases
    2.2.1.9  2-succinyl-5-enolpyruvyl-6-hydroxy-3-cyclohexene-1-carboxylic-acid synthase
     BWG_2038 (menD)
SSDB
Motif
Pfam: TPP_enzyme_M_2 TPP_enzyme_N TPP_enzyme_C
Other DBs
NCBI-ProteinID: ACR62066
UniProt: C4ZUA7
Structure
PDB: 

Position
complement(2261416..2263086)
AA seq 556 aa
MSVSAFNRRWAAVILEALTRHGVRHICIAPGSRSTPLTLAAAENSAFIHHTHFDERGLGH
LALGLAKVSKQPVAVIVTSGTAVANLYPALIEAGLTGEKLILLTADRPPELIDCGANQAI
RQPGMFASHPTHSISLPRPTQDIPARWLVSTIDHALGTLHAGGVHINCPFAEPLYGEMDD
TGLSWQQRLGDWWQDDKPWLREAPRLESEKQRDWFFWRQKRGVVVAGRMSAEEGKKVALW
AQTLGWPLIGDVLSQTGQPLPCADLWLGNAKATSELQQAQIVVQLGSSLTGKRLLQWQAS
CEPEEYWIVDDIEGRLDPAHHRGRRLIANIADWLELHPAEKRQPWCVEIPRLAEQAMQAV
IARRDAFGEAQLAHRICDYLPEQGQLFVGNSLVVRLIDALSQLPAGYPVYSNRGASGIDG
LLSTAAGVQRASGKPTLAIVGDLSALYDLNALALLRQVSAPLVLIVVNNNGGQIFSLLPT
PQSERERFYLMPQNVHFEHAAAMFELKYHRPQNWQELETAFADAWRTPTTTVIEMVVNDT
DGAQTLQQLLAQVSHL
NT seq 1671 nt   +upstreamnt  +downstreamnt
atgtcagtaagcgcatttaaccgacgctgggcggcggtcattctggaagcattaacgcgt
cacggcgtcagacacatctgtatcgccccaggctcgcgttctacaccgttaacgttagcg
gcggcggagaattccgcattcattcaccacacccatttcgatgagcgtgggttggggcat
ctggcgctggggctggcgaaagtcagcaagcagccggtggcggtgattgtgacctccggc
acggcggtggcaaatctctatccggcactgattgaagccgggttaaccggagaaaaactg
attctcttaaccgccgatcgcccgccggagctaattgactgcggcgcgaatcaggcaatt
cgccagccgggaatgttcgcctctcaccccacgcacagtatttcattgccgcgcccgacc
caggatatccccgcacgttggctggtttctaccatcgaccacgctctcggtacgcttcat
gcggggggagtccatatcaactgcccgtttgctgaaccgctgtatggcgaaatggacgat
accgggcttagctggcaacagcgtctgggtgactggtggcaggacgacaaaccgtggctg
cgtgaagcgcctcgtctggaaagtgaaaaacagcgcgactggttcttctggcgacaaaag
cgcggcgtggtggttgccgggcgcatgagtgcggaagagggcaaaaaagttgccctgtgg
gcgcaaactcttggctggccgctgattggcgatgtgctgtcacaaaccgggcagccgctg
ccgtgtgccgatctttggttaggcaatgccaaagcgaccagcgagctgcagcaggcgcaa
attgtggtgcaactgggaagcagcctgacggggaaacggctcctgcaatggcaggcaagc
tgtgaaccagaagagtactggattgttgatgacattgaagggcgacttgatccggcacac
catcgcggacgtcgcttaattgccaatattgccgactggctggagctgcatccggcagaa
aaacgccagccctggtgcgttgaaatcccgcgcctggcggaacaggcaatgcaggcggtt
attgcccgccgtgatgcgtttggcgaagcgcaactggcgcatcgcatctgcgactatctg
cctgaacaggggcaattgtttgttggtaacagcctggtggtacgtctgattgatgcgctt
tcgcaacttccggcaggttacccggtgtacagcaaccgtggggccagcggtatcgacggg
ctgctttcgaccgccgccggcgttcagcgggcaagcggcaaaccgacgctggcgattgtg
ggcgatctctccgcactttacgatctcaacgcgctggcgttattgcgtcaggtttctgcg
ccgctggtattaattgtggtgaacaacaacggcgggcaaattttctcgctgttgccaacg
ccgcaaagcgagcgtgagcgtttctatctgatgccgcaaaacgtccattttgagcacgcc
gccgcgatgttcgagctgaaatatcatcgtccgcaaaactggcaggaacttgaaacggca
tttgccgacgcctggcgcacgccaaccaccacggtgattgaaatggtggttaacgacacc
gatggtgcgcaaacgctccagcaacttctggcgcaggtaagccatttatga

DBGET integrated database retrieval system