KEGG   Escherichia coli K-12 BW2952: BWG_2082Help
Entry
BWG_2082          CDS       T00913                                 

Gene name
hisQ
Definition
(GenBank) histidine/lysine/arginine/ornithine transporter subunit
  KO
K10016  histidine transport system permease protein
Organism
ebw  Escherichia coli K-12 BW2952
Pathway
ebw02010  ABC transporters
Brite
KEGG Orthology (KO) [BR:ebw00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    BWG_2082 (hisQ)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:ebw02000]
    BWG_2082 (hisQ)
Transporters [BR:ebw02000]
 ABC transporters, prokaryotic type
  Phosphate and amino acid transporters
   Lysine/arginine/ornithine transporter
    BWG_2082 (hisQ)
   Histidine transporter
    BWG_2082 (hisQ)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: BPD_transp_1 DcuC
Motif
Other DBs
NCBI-ProteinID: ACR63420
Position
complement(2309057..2309743)
Genome map
AA seq 228 aa AA seqDB search
MLYGFSGVILQGALVTLELAISSVVLAVIIGLIGAGGKLSQNRLSGLIFEGYTTLIRGVP
DLVLMLLIFYGLQIALNTVTEAMGVGQIDIDPMVAGIITLGFIYGAYFTETFRGAFMAVP
KGHIEAATAFGFTRGQVFRRIMFPSMMRYALPGIGNNWQVILKSTALVSLLGLEDVVKAT
QLAGKSTWEPFYFAIVCGVIYLVFTTVSNGVLLFLERRYSVGVKRADL
NT seq 687 nt NT seq  +upstreamnt  +downstreamnt
atgttgtatgggttttcaggtgttattttacagggtgcgctcgtcacgctggagctggct
atcagctctgtagtgctcgctgtaatcatcggtttaattggcgctggcggtaagctctcg
caaaatcggctttcggggctgattttcgaagggtacaccacgctgattcgtggcgtgccg
gacttagtgttgatgctgctgattttctacggtttgcagattgcgctaaacacggtgacg
gaggcgatgggcgtcgggcagattgatatcgatccgatggtcgctggtattatcactctc
ggttttatctacggtgcttattttaccgaaacgttccgtggtgcttttatggcagtgccg
aaaggacatatagaggcggcgacggcgttcggttttactcgtgggcaagtgtttcggcgg
atcatgtttccgtcgatgatgcgttacgccctgccaggcattggcaacaactggcaggtg
atcctcaaatctaccgcactggtttcgttactcggcctggaagatgtggtcaaagccacc
caactggcaggcaaaagtacctgggaaccgttctatttcgccatcgtctgtggcgtgatt
tacctggttttcaccactgtttccaatggtgtgctgctgttccttgagcgccgctactcc
gtgggtgtgaagagggctgacctgtga

DBGET integrated database retrieval system