KEGG   Escherichia coli K-12 BW2952: BWG_2542
Entry
BWG_2542          CDS       T00913                                 

Gene name
fucU
Definition
(GenBank) L-fucose mutarotase
  KO
K02431  L-fucose mutarotase [EC:5.1.3.29]
Organism
ebw  Escherichia coli K-12 BW2952
Brite
KEGG Orthology (KO) [BR:ebw00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    BWG_2542 (fucU)
Enzymes [BR:ebw01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.29  L-fucose mutarotase
     BWG_2542 (fucU)
SSDB
Motif
Pfam: RbsD_FucU
Other DBs
NCBI-ProteinID: ACR63646
UniProt: C4ZZV9
Structure
PDB: 
2WCV

Position
2824058..2824480
AA seq 140 aa
MLKTISPLISPELLKVLAEMGHGDEIIFSDAHFPAHSMGPQVIRADGLLVSDLLQAIIPL
FELDSYAPPLVMMAAVEGDTLDPEVERRYRNALSLQAPCPDIIRINRFAFYERAQKAFAI
VITGERAKYGNILLKKGVTP
NT seq 423 nt   +upstreamnt  +downstreamnt
atgctgaaaacaatttcgccgttaatttctcccgaactattgaaagtgctggcagagatg
ggacatggagatgaaattattttttccgatgctcactttcccgcccattcgatgggaccg
caggtgatccgcgctgatggcctgttggtgagcgacttgctccaggcgattatcccgtta
tttgaactggacagttatgcaccgccgctggtgatgatggcggcggtagaaggtgacact
ctcgatcctgaagtagaacgacgttaccgtaatgcgctttcactacaagccccgtgtcct
gacatcatccgcatcaatcgttttgcgttttatgaacgggcgcaaaaagcctttgcgatc
gttatcacaggcgaacgagcgaagtacgggaatattcttttaaaaaaaggggtaacaccg
taa

DBGET integrated database retrieval system