KEGG   Escherichia coli K-12 BW2952: BWG_2685
Entry
BWG_2685          CDS       T00913                                 

Gene name
mltC
Definition
(GenBank) membrane-bound lytic murein transglycosylase C
  KO
K08306  membrane-bound lytic murein transglycosylase C [EC:4.2.2.-]
Organism
ebw  Escherichia coli K-12 BW2952
Brite
KEGG Orthology (KO) [BR:ebw00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:ebw01011]
    BWG_2685 (mltC)
Enzymes [BR:ebw01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.2  Acting on polysaccharides
    4.2.2.-  
     BWG_2685 (mltC)
Peptidoglycan biosynthesis and degradation proteins [BR:ebw01011]
 Peptidoglycan biosynthesis and degradation
  Lytic transglycosylase
   BWG_2685 (mltC)
SSDB
Motif
Pfam: Mltc_N SLT SLT_2 Lysozyme_like
Other DBs
NCBI-ProteinID: ACR63750
UniProt: C5A0N2
Structure
PDB: 
4CFP 4C5F 4CHX 4CFO

Position
2989603..2990682
AA seq 359 aa
MKKYLALALIAPLLISCSTTKKGDTYNEAWVKDTNGFDILMGQFAHNIENIWGFKEVVIA
GPKDYVKYTDQYQTRSHINFDDGTITIETIAGTEPAAHLRRAIIKTLLMGDDPSSVDLYS
DVDDITISKEPFLYGQVVDNTGQPIRWEGRASNFADYLLKNRLKSRSNGLRIIYSVTINM
VPNHLDKRAHKYLGMVRQASRKYGVDESLILAIMQTESSFNPYAVSRSDALGLMQVVQHT
AGKDVFRSQGKSGTPSRSFLFDPASNIDTGTAYLAMLNNVYLGGIDNPTSRRYAVITAYN
GGAGSVLRVFSNDKIQAANIINTMTPGDVYQTLTTRHPSAESRRYLYKVNTAQKSYRRR
NT seq 1080 nt   +upstreamnt  +downstreamnt
atgaaaaaatatctcgcgctggctttgattgcgccgttgctcatctcctgttcgacgacc
aaaaaaggcgatacctataacgaagcctgggtcaaagataccaacggttttgatattctg
atggggcaatttgcccacaatattgagaacatctggggcttcaaagaggtggtgatcgct
ggtcctaaggactacgtgaaatacaccgatcaatatcagacccgcagccacatcaacttc
gatgacggtacgattactatcgaaaccatcgccgggacagaacctgccgcgcatttgcgc
cgggcaattatcaaaacgttattgatgggtgacgatccgagttcggtcgatctctattcc
gacgttgatgatattacgatttcgaaagaacctttcctttacggtcaggtggtggacaac
accgggcagccgattcgctgggaaggtcgcgcaagcaacttcgcggattatctgctgaaa
aaccgtctgaagagccgcagcaacgggctgcgtatcatctacagcgtcaccattaacatg
gtgccgaaccaccttgataaacgtgcgcacaaatatctcggcatggtccgccaggcgtca
cggaaatatggcgttgatgagtcgctgattctggcaattatgcagaccgaatcttccttt
aacccgtatgcggtcagccgttccgatgcgctgggattaatgcaggtggtacaacatact
gccgggaaagatgtgttccgctcgcaggggaaatccggcacgccgagccgcagtttcttg
tttgatcctgccagcaatattgataccggcaccgcgtatctggcgatgctgaacaatgtt
tatctcggcggaattgataacccaacatcgcggcgttatgccgtcatcaccgcctataac
ggcggcgcaggcagcgtgctgcgagtcttttcgaatgataagattcaggctgccaatatt
attaacaccatgacgccgggcgatgtttatcagacgctgacgacccgccatccctctgcg
gaatctcgccgttatctttataaagtgaataccgcgcaaaaatcctaccgccgccgataa

DBGET integrated database retrieval system