KEGG   Escherichia coli K-12 BW2952: BWG_3376Help
Entry
BWG_3376          CDS       T00913                                 

Gene name
ibpB
Definition
(GenBank) heat shock chaperone
  KO
K04081  molecular chaperone IbpB
Organism
ebw  Escherichia coli K-12 BW2952
Brite
KEGG Orthology (KO) [BR:ebw00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03110 Chaperones and folding catalysts [BR:ebw03110]
    BWG_3376 (ibpB)
Chaperones and folding catalysts [BR:ebw03110]
 Heat shock proteins
  HSP20
   BWG_3376 (ibpB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HSP20 ArsA_HSP20
Motif
Other DBs
NCBI-ProteinID: ACR63399
UniProt: C4ZYW3
Position
complement(3752825..3753253)
Genome map
AA seq 142 aa AA seqDB search
MRNFDLSPLMRQWIGFDKLANALQNAGESQSFPPYNIEKSDDNHYRITLALAGFRQEDLE
IQLEGTRLSVKGTPEQPKEEKKWLHQGLMNQPFSLSFTLAENMEVSGATFVNGLLHIDLI
RNEPEPIAAQRIAISERPALNS
NT seq 429 nt NT seq  +upstreamnt  +downstreamnt
atgcgtaacttcgatttatccccactgatgcgtcaatggatcggttttgacaaactggcc
aacgcactgcaaaacgccggtgaaagccagagcttcccgccgtacaacattgagaaaagc
gacgataaccactaccgcattacccttgcgctggcaggtttccgtcaggaagatttagag
attcaactggaaggtacgcgcctgagcgtaaaaggcacgccggagcagccaaaagaagag
aaaaaatggctgcatcaagggcttatgaatcagccatttagcctgagctttacgctggct
gaaaatatggaagtctctggcgcaaccttcgtaaacggtttactgcatattgatttaatt
cgtaatgagcctgaacccatcgcagcgcagcgtatcgctatcagcgaacgtcccgcgtta
aatagctaa

DBGET integrated database retrieval system