KEGG   Escherichia coli BW2952: BWG_3432Help
Entry
BWG_3432          CDS       T00913                                 

Gene name
mnmG
Definition
(GenBank) glucose-inhibited cell-division protein
  KO
K03495  tRNA uridine 5-carboxymethylaminomethyl modification enzyme
Organism
ebw  Escherichia coli BW2952
Brite
KEGG Orthology (KO) [BR:ebw00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:ebw03016]
    BWG_3432 (mnmG)
   03036 Chromosome and associated proteins [BR:ebw03036]
    BWG_3432 (mnmG)
Transfer RNA biogenesis [BR:ebw03016]
 Eukaryotic Type
  tRNA modification factors
   Other tRNA modification factors
    BWG_3432 (mnmG)
 Prokaryotic Type
    BWG_3432 (mnmG)
Chromosome and associated proteins [BR:ebw03036]
 Prokaryotic Type
  Chromosome partitioning proteins
   Other chromosome partitioning proteins
    BWG_3432 (mnmG)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GIDA GIDA_assoc FAD_binding_2 FAD_oxidored Pyr_redox_2 AlaDh_PNT_C HI0933_like DAO Thi4 Pyr_redox MarR_2 FAD_binding_3 Pyr_redox_3 NAD_binding_9
Motif
Other DBs
NCBI-ProteinID: ACR63319
UniProt: C4ZZ19
Structure
PDB: 

Position
complement(3810100..3811989)
Genome map
AA seq 629 aa AA seqDB search
MFYPDPFDVIIIGGGHAGTEAAMAAARMGQQTLLLTHNIDTLGQMSCNPAIGGIGKGHLV
KEVDALGGLMAKAIDQAGIQFRILNASKGPAVRATRAQADRVLYRQAVRTALENQPNLMI
FQQAVEDLIVENDRVVGAVTQMGLKFRAKAVVLTVGTFLDGKIHIGLDNYSGGRAGDPPS
IPLSRRLRELPLRVGRLKTGTPPRIDARTIDFSVLAQQHGDNPMPVFSFMGNASQHPQQV
PCYITHTNEKTHDVIRSNLDRSPMYAGVIEGVGPRYCPSIEDKVMRFADRNQHQIFLEPE
GLTSNEIYPNGISTSLPFDVQMQIVRSMQGMENAKIVRPGYAIEYDFFDPRDLKPTLESK
FIQGLFFAGQINGTTGYEEAAAQGLLAGLNAARLSADKEGWAPARSQAYLGVLVDDLCTL
GTKEPYRMFTSRAEYRLMLREDNADLRLTEIGRELGLVDDERWARFNEKLENIERERQRL
KSTWVTPSAEAAAEVNAHLTAPLSREASGEDLLRRPEMTYEKLTTLTPFAPALTDEQAAE
QVEIQVKYEGYIARQQDEIEKQLRNENTLLPATLDYRQVSGLSNEVIAKLNDHKPASIGQ
ASRISGVTPAAISILLVWLKKQGMLRRSA
NT seq 1890 nt NT seq  +upstreamnt  +downstreamnt
atgttttatccggatccttttgacgtcatcatcattggcgggggtcatgcaggcaccgag
gccgcgatggccgcggcgcgtatgggtcaacagactctgcttttgacacacaatatcgac
actctggggcagatgagctgcaacccggcgatcggcggtattgggaagggacatctggta
aaagaagtggatgcactcggcggtctgatggcgaaagcgatcgatcaggcgggtatccag
tttaggatactaaacgcaagcaaaggaccggcggttcgcgctacccgagctcaggcggat
cgtgtgctctaccgtcaggcggtacgtacggcgctggagaaccaaccgaacctgatgatc
ttccagcaggcggttgaagatcttattgtcgaaaacgatcgcgtggtcggtgctgttacc
caaatgggactgaagttccgtgccaaagccgtcgtgctcaccgttgggacgttcctcgac
ggtaaaattcatatcggtctggataattacagcggtggccgtgctggtgatccgccgtcc
attccgctttctcgccgtttgcgtgaactgccgctgcgcgttggtcgtctgaaaaccggg
acaccaccgcgtattgatgctcgaaccatcgactttagcgtactggcgcaacagcatggc
gataacccaatgccggtattctcgtttatgggcaatgcgtcccagcatccccagcaggtg
ccgtgttatatcactcataccaacgagaaaacccatgatgtgatccgcagtaacctcgat
cgtagcccaatgtacgcaggggtgatcgaaggtgtcggcccacgctactgcccgtcgatc
gaagacaaagtcatgcgcttcgccgacagaaatcagcatcagatcttccttgaaccggaa
ggactgacctctaatgaaatttatccgaacggtatctccaccagcctgccgttcgatgtg
cagatgcaaatcgtccgctctatgcaggggatggaaaacgcgaagatcgtgcgtccgggt
tatgccattgagtatgacttcttcgatcctcgcgacctgaaaccgacgctggagagcaag
tttatccaggggctgttctttgctggtcagattaacggcactaccggttacgaagaagcc
gctgcgcaaggtttgctggccggtcttaacgctgcccgtctgtctgctgacaaagaaggt
tgggctccggcacgttctcaggcgtatctcggcgtactagttgatgacctgtgcacttta
ggaaccaaagaaccgtatcgtatgtttacttcgcgcgcagaatatcgtctgatgctacgc
gaagataatgcggatctgcgtttgactgaaatcggtcgtgaactgggcctggtggatgac
gaacgttgggcgcgctttaacgagaaacttgagaatatcgagcgtgagcgtcagcgtctg
aaatcgacctgggtaaccccgtcggcggaagctgcagccgaagtgaatgctcacctgact
gcgccgctttcccgtgaagccagtggtgaagatctgctgcgtcgtccggaaatgacttat
gaaaaattaaccacgctgacgccgtttgcccctgcgttgacagacgaacaggcggcggaa
caggttgagattcaggttaaatacgaaggttatatcgcgcgccagcaagatgagatcgaa
aagcagctgcgtaacgagaacaccctgctacccgcgacactggattaccgccaggtatcc
ggtctttctaacgaagtgatcgccaaacttaacgatcacaaaccagcctctatcggccaa
gcttcgcgtatttctggcgtcacgcctgcggccatctccattctgctggtgtggctgaaa
aaacagggtatgctgcgtcgtagcgcataa

DBGET integrated database retrieval system