KEGG   Escherichia coli BW2952: BWG_3588Help
Entry
BWG_3588          CDS       T00913                                 

Gene name
tpiA
Definition
(GenBank) triosephosphate isomerase
  KO
K01803  triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
ebw  Escherichia coli BW2952
Pathway
ebw00010  Glycolysis / Gluconeogenesis
ebw00051  Fructose and mannose metabolism
ebw00562  Inositol phosphate metabolism
ebw01100  Metabolic pathways
ebw01110  Biosynthesis of secondary metabolites
ebw01120  Microbial metabolism in diverse environments
ebw01130  Biosynthesis of antibiotics
ebw01200  Carbon metabolism
ebw01230  Biosynthesis of amino acids
Module
ebw_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
ebw_M00002  Glycolysis, core module involving three-carbon compounds
ebw_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:ebw00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BWG_3588 (tpiA)
   00051 Fructose and mannose metabolism
    BWG_3588 (tpiA)
   00562 Inositol phosphate metabolism
    BWG_3588 (tpiA)
Enzymes [BR:ebw01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     BWG_3588 (tpiA)
Exosome [BR:ebw04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   BWG_3588 (tpiA)
  Exosomal proteins of bladder cancer cells
   BWG_3588 (tpiA)
  Exosomal proteins of melanoma cells
   BWG_3588 (tpiA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TIM
Motif
Other DBs
NCBI-ProteinID: ACR65700
Structure
PDB: 

Position
complement(3998432..3999199)
Genome map
AA seq 255 aa AA seqDB search
MRHPLVMGNWKLNGSRHMVHELVSNLRKELAGVAGCAVAIAPPEMYIDMAKREAEGSHIM
LGAQNVDLNLSGAFTGETSAAMLKDIGAQYIIIGHSERRTYHKESDELIAKKFAVLKEQG
LTPVLCIGETEAENEAGKTEEVCARQIDAVLKTQGAAAFEGAVIAYEPVWAIGTGKSATP
AQAQAVHKFIRDHIAKVDANIAEQVIIQYGGSVNASNAAELFAQPDIDGALVGGASLKAD
AFAVIVKAAEAAKQA
NT seq 768 nt NT seq  +upstreamnt  +downstreamnt
atgcgacatcctttagtgatgggtaactggaaactgaacggcagccgccacatggttcac
gagctggtttctaacctgcgtaaagagctggcaggtgttgctggctgtgcggttgcaatc
gcaccaccggaaatgtatatcgatatggcgaagcgcgaagctgaaggcagccacatcatg
ctgggtgcgcaaaacgtggacctgaacctgtccggcgcattcaccggtgaaacctctgct
gctatgctgaaagacatcggcgcacagtacatcatcatcggtcactctgaacgtcgtact
taccacaaagaatctgacgaactgatcgcgaaaaaattcgcggtgctgaaagagcagggc
ctgactccggttctgtgcatcggtgaaaccgaagctgaaaatgaagcgggcaaaactgaa
gaagtttgcgcacgtcagatcgacgcggtactgaaaactcagggtgctgcggcattcgaa
ggtgcggttatcgcttacgaacctgtatgggcaatcggtactggcaaatctgcaactccg
gctcaggcacaggctgttcacaaattcatccgtgaccacatcgctaaagttgacgctaac
atcgctgaacaagtgatcattcagtacggcggctctgtaaacgcgtctaacgctgcagaa
ctgtttgctcagccggatatcgacggcgcgctggttggtggtgcttctctgaaagctgac
gccttcgcagtaatcgttaaagctgcagaagcggctaaacaggcttaa

DBGET integrated database retrieval system