KEGG   Pectobacterium atrosepticum SCRI1043: ECA0382Help
Entry
ECA0382           CDS       T00186                                 

Gene name
pyrB
Definition
(GenBank) aspartate carbamoyltransferase catalytic subunit
  KO
K00609  aspartate carbamoyltransferase catalytic subunit [EC:2.1.3.2]
Organism
eca  Pectobacterium atrosepticum SCRI1043
Pathway
eca00240  Pyrimidine metabolism
eca00250  Alanine, aspartate and glutamate metabolism
eca01100  Metabolic pathways
Module
eca_M00051  Uridine monophosphate biosynthesis, glutamine (+ PRPP) => UMP
Brite
KEGG Orthology (KO) [BR:eca00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    ECA0382 (pyrB)
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    ECA0382 (pyrB)
Enzymes [BR:eca01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.3  Carboxy- and carbamoyltransferases
    2.1.3.2  aspartate carbamoyltransferase
     ECA0382 (pyrB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: OTCace_N OTCace
Motif
Other DBs
NCBI-ProteinID: CAG73301
GeneDB: ECA0382
UniProt: Q6DA73
Position
complement(432459..433394)
Genome map
AA seq 311 aa AA seqDB search
MVNPLYQKHIISINDLSREDLELALNVAASLKAKPQPELLKHKVIASCFFEASTRTRLSF
ETAMHRLGASVVGFADSNNTSLGKKGETLADTISVISQYVDAIVMRHPQEGASRLATEFS
GGIPVLNAGDGANQHPTQTLLDLFTIQETQGRLNNINIAMVGDLKYGRTVHSLTQALAKF
EGNRFYFIAPDALAMPDYILSMLKEKNIAYSLHNSIDEVVGELDILYMTRVQKERLDPSE
YINIKSQFVLRAADLDNARPNLKVLHPLPRVDEITIDVDTTPYAYYFQQAGNGIYARQAL
LALVLNRELVL
NT seq 936 nt NT seq  +upstreamnt  +downstreamnt
atggtcaatccgctctatcaaaaacatatcatttcgattaacgatctcagccgggaagat
ttggaactggcgctgaatgtcgctgccagtctgaaagccaagccccagcctgagctgtta
aaacataaagtgattgccagctgcttcttcgaagcctccacacggacgcgtttatccttt
gaaaccgcgatgcatcgcttaggagcatccgtcgtcggtttcgccgacagcaacaacacc
tcgctggggaaaaagggcgaaacgctggccgacaccatctccgtcatcagccaatatgtt
gatgccatcgtgatgcgtcatccacaggaaggcgcgtcccgccttgctaccgagttttcc
ggcggtattcccgtgctgaacgcgggtgatggtgcgaaccagcacccgacgcaaacgctg
ctcgatctgttcaccattcaggaaacgcaaggccgactgaacaacatcaacatcgcgatg
gtcggtgatttgaaatatggccgtaccgtgcattcactcacgcaggcgctggcgaagttc
gaaggcaaccgcttctacttcatcgctccagacgcgttggccatgccggactacattctg
agcatgctgaaagagaagaacattgcttacagcctgcacaacagcatcgacgaagtcgtg
ggtgagctggatattctgtacatgacgcgcgtccagaaagagcgtctggatccgtccgaa
tacatcaacatcaaatcccagtttgtcctgcgtgctgccgacttggacaacgcccgcccg
aatttgaaagtgctgcacccgctgccgcgcgtcgatgagatcaccattgatgtggatacc
acgccctatgcctattatttccaacaggcgggcaacggtatttacgcccgtcaggcactg
ctggcgctggtcctgaatcgcgaactggttctgtaa

DBGET integrated database retrieval system