KEGG   Pectobacterium atrosepticum SCRI1043: ECA0560Help
Entry
ECA0560           CDS       T00186                                 

Definition
(GenBank) putative plasmid transfer protein
Organism
eca  Pectobacterium atrosepticum SCRI1043
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TrwB_AAD_bind TraG-D_C DUF87 AAA_16
Motif
Other DBs
NCBI-ProteinID: CAG73475
GeneDB: ECA0560
UniProt: Q6D9Q5
Position
626208..628304
Genome map
AA seq 698 aa AA seqDB search
MSDRYVIEALLRPAVELNTAVVSATAAFVCVQAPWAIALAPSVSYVTAGGFAVLAMVRTR
QGMKVLRYRRNLRRLPRYVMSSKQIPVSKRRLFIGKGFMWTQKHTQRLRDTLRPEVERYI
QPPTLYQAARKLENAAEHNLPWLTKLLSVDSPLNPVRPLPPVGGKPVLHGIEPDEVDVTM
PLADRPGHTIVLGTTRVGKTRLAELFITQDIRRGDVTIVFDPKGDPDLLRRVWAEAHRAG
RGDSLYIFHLGWPEISARYNAVGRFGRVSEVASRISGQLAGEGNSAAFKEFAWRFVNIVA
RALVALGERPDYTLIMRYVNNIADLYLRYAEKIIEEELPELQLQIRNNLGVFTDEDVPRN
MQGQPNSVGIWAIEVALSSEAGKKLYDPILDGLRSAVRYDRTYFDKIVASLLPLLEKLTT
GKTASLLSPDYLDMDDSRPIFDWEQIVRKRGVVYIGLDALTDSEVATAVGNSMFADLVSV
AGHIYKHGINAGLPQQKEEKAVINLHCDEFNELMGDEFIPLINKGGGAGVQVTAYTQTSS
DIEARIGNAAKTAQVIGNFNTLIMLRVRDNKTAELLTTQLPQVEIYSKTLVSGHSDTANV
ETGQDFTSSTQDRVGTIKTPLIEPSDVVSLPKGQAFALLEGGQLWKIRMPLPTNDIDDAM
MPANLQAVATEMRRNYHSSEGWWSGRSLTAADRQVGGE
NT seq 2097 nt NT seq  +upstreamnt  +downstreamnt
atgagcgatcgttatgtcattgaggcattgctgcggcccgctgttgaactgaacactgcc
gtagtttcggctacagcagcatttgtctgtgtgcaggcaccatgggcgattgcgttggcc
ccttcagtcagttatgtgacggccggtgggttcgctgttctggccatggtacgaacccgc
cagggaatgaaggtactgcgttaccgtcgtaatttacgacgcctaccacgttacgtgatg
agtagtaagcagatccctgtaagtaaacggcggttgtttatcggtaagggatttatgtgg
acgcagaaacacacccaacggctgcgtgacacgttacgtccggaggtcgagcgttatatt
cagccgccaaccctgtatcaggccgcccgtaaactagagaatgcagcagagcataacttg
ccctggctcacgaaactactgagcgtagattctcctctgaacccagtgcgcccattaccg
cccgtcggtggaaagccggtactacatggtattgagcctgatgaggttgatgtcactatg
ccactggccgatcgccccggtcataccatcgtattgggtacgactcgtgttggaaaaaca
cggttggccgaactgtttattacccaggatatccgccgtggtgatgtgacgattgtcttc
gatccaaagggtgaccctgatttattacgtcgagtctgggctgaagcgcaccgtgccggg
cgaggtgattcgctctacatcttccatctgggttggcccgaaatatcagctcgttataac
gccgttggacggtttgggcgtgtctctgaagtggcgtcgcgtatctctgggcaattggcg
ggggaagggaacagtgctgcatttaaagagtttgcgtggcgtttcgtaaatattgtagcc
agagcactggttgcattgggtgagcggcctgactacacgctaattatgcgttacgtcaat
aatattgcggacctgtatctacgctatgctgagaaaatcattgaagaggaactacccgag
ctacaactgcagatacgcaataacttaggggtattcactgatgaagatgttccccgaaat
atgcagggccagcctaatagcgttggcatttgggcaatagaggttgcgttaagctcagag
gccggtaagaaactctatgatccgattttggatggcttgcgctctgcggttcgctatgac
agaacttatttcgacaaaattgttgcctctttattaccattattggagaaactgacgacg
ggtaaaacggcgtccctgttgtcgccggactatctggatatggatgactcacgccccatt
tttgattgggaacaaattgttcgcaaacgaggtgttgtgtatatcggtctggacgccctt
acagacagtgaagttgctacggcagtggggaacagcatgtttgccgatctggttagcgtg
gctggccatatttataaacatggtattaatgctggactgccacagcagaaagaagaaaaa
gccgtcattaacctgcattgcgatgagttcaatgagctaatgggtgatgaattcattccg
ttgatcaacaaaggcggtggtgctggcgttcaagtgaccgcctatacgcaaacttcatca
gatatcgaggcgcgtatcgggaatgctgcgaaaacggctcaggtcattggtaacttcaat
acactgatcatgctgcgtgtccgggacaacaaaactgcagaattgctcacgacacagctg
ccgcaggttgagatctacagtaaaacgttggtttctggtcactcggatacggctaatgtt
gagactggacaggattttacatccagtactcaggatcgtgttggtacgataaaaaccccg
ttgattgagccgtctgatgtcgtcagcctgcctaaaggccaggcgttcgccctgcttgaa
ggtggtcagttgtggaaaatcaggatgccgctgccgaccaatgatattgatgatgcgatg
atgccagcaaacttgcaggctgtggcgacagaaatgcgccgtaactatcattccagtgag
ggatggtggagcgggcgttcacttactgctgcagatcggcaagtgggaggtgagtag

DBGET integrated database retrieval system