KEGG   Pectobacterium atrosepticum SCRI1043: ECA0568
Entry
ECA0568           CDS       T00186                                 

Definition
(GenBank) putative membrane protein
Organism
eca  Pectobacterium atrosepticum SCRI1043
SSDB
Motif
Pfam: DUF2895
Other DBs
NCBI-ProteinID: CAG73483
GeneDB: ECA0568
UniProt: Q6D9P7
Position
631392..632048
AA seq 218 aa
MSIYRNAVRNRDQHILTLRIACGVLVVLLLVTILGWMRAPSNLTVHNPPDLRAGSTKPWW
EVPAPTVYSFAFYIFQQLNAWPKNGEQDYPGKIFSLSPYLTPSCLDFLNADAKKRSLGNE
LLDRVRVVYEIPGRGYSAESVDVISRDNWVVRLDLVTDEYYHTEPVKRVLVRYPLKVVRW
DGDAERNPFGLALDCYDAMPQRLEISHQPQPEKKGIMQ
NT seq 657 nt   +upstreamnt  +downstreamnt
atgagcatctaccgtaacgcggtaagaaatcgcgaccaacatatcctgacattacgcatt
gcctgtggcgttctggtagttctgttactggtcacgatacttggctggatgcgggcacct
agcaatttgacggttcacaatcctccagatctccgggctggtagtaccaagccctggtgg
gaagtgccggcacctacagtctatagctttgcgttctacattttccagcagttgaatgcc
tggccgaaaaatggcgaacaggactaccccggcaagatattcagcctatccccgtacctg
acgccatcttgtctggattttctgaatgcagacgcgaaaaaacgctcattgggtaatgag
ttactggaccgcgttcgtgtggtttacgagatacccgggcgtgggtacagcgcggagagt
gtagatgttatcagccgtgataactgggttgtccgtctggatctggtgactgatgagtat
tatcacaccgaacctgtcaaacgcgtactggtgcgttacccgctaaaagtcgttcgctgg
gatggggatgctgaacgtaacccgtttggcctggcactggattgttatgacgctatgcca
cagcgtttggaaatttcacatcagcctcagccagagaaaaaggggattatgcagtga

DBGET integrated database retrieval system