KEGG   Pectobacterium atrosepticum SCRI1043: ECA0576
Entry
ECA0576           CDS       T00186                                 

Definition
(GenBank) putative exported protein
Organism
eca  Pectobacterium atrosepticum SCRI1043
SSDB
Motif
Pfam: DUF1525
Other DBs
NCBI-ProteinID: CAG73491
GeneDB: ECA0576
UniProt: Q6D9N9
Position
639329..639733
AA seq 134 aa
MCSKIAVFLFLLSPAPLLANPVVYTDQQHPPTNLTPETQIVWLDAPERLQRSVFGEFPAS
MEQATVQAQVVMRSPKWQQHENDLQTAYRGVVHAWEIGVRKYPAVVFDDRDVVYGTADVA
MAIAYKMQEGGSHE
NT seq 405 nt   +upstreamnt  +downstreamnt
atgtgcagcaaaatagccgtttttctttttttactctcacctgcgccattactggccaat
cccgttgtttataccgaccagcaacatcctcctaccaatcttacccccgagactcagata
gtctggctggatgctccggaacggttgcagcgttccgtgtttggcgagtttcccgcatcg
atggaacaagcgacagtacaagctcaggttgttatgcgctccccgaagtggcaacagcat
gagaatgacctgcaaacggcctatcgtggtgtggtgcatgcatgggaaattggcgtgcgc
aaatatcctgctgttgtttttgacgatcgcgacgtggtgtacggtactgctgatgttgcc
atggctatcgcatataaaatgcaagaagggggtagccatgagtaa

DBGET integrated database retrieval system