KEGG   Pectobacterium atrosepticum SCRI1043: ECA0578
Entry
ECA0578           CDS       T00186                                 
Name
(GenBank) putative exported protein
Organism
eca  Pectobacterium atrosepticum SCRI1043
SSDB
Motif
Pfam: ParB DivIC
Other DBs
NCBI-ProteinID: CAG73493
UniProt: Q6D9N7
Position
640710..642134
AA seq 474 aa
MNMKFCVLAIGLQWVTPCVLADQFNVNLPQANSGALGYGADVSGAVSDKLFYTLGGGSVI
SQPATRISMQKLGVDLGWSSDLQCGNFDLKTTVGNQLNGVTSGYKNLMGEVIQGATGAVS
SLPGAIIQRASPGLYDMLTNGVLQANVAFDKAMFNCQNMTKRMMDFSDSSKWTQSAQADE
YKQLVNSGKADAIQTDNDSQKLTGNNGQNWIGGQRRGGKGQPAIRPTHDLAAAGYNMMNS
QPALSTSSVSTSNCTGSVCQKFPNSEEAAKAVVQVLGDRSMRTCKVATDCTSGDEGQQPG
TTQAGTGFAPMLEEATKANLEQLVKMVNGAEKPTAANLGKLKAGSLTITSGVIRALQRDP
DNAALTGRLASELAMADTVETALLMRRMLMTGMSEPNAAAQEAAVDEGTRRIESLDREIN
ALKNEMELKRELARNSVLTIIERENSRVETNPQKQIQDNTDMRVNQMTTPVQGK
NT seq 1425 nt   +upstreamnt  +downstreamnt
atgaacatgaaattttgcgtgttggctattggtctgcaatgggttacgccgtgcgttctg
gccgatcagttcaacgtcaatttaccccaggcgaacagcggagcgctggggtatggggct
gatgtcagtggtgctgtgtcagataaactcttttatacgctcggtggcggttctgtgatt
tcgcagccggcaacgcgtatcagtatgcagaagctgggtgttgatctcggttggagttct
gatttgcagtgtggcaattttgacctgaaaacgacggtcggcaatcagttgaatggcgtg
acatccggatacaaaaacctgatgggggaagtcattcagggggcgaccggtgcggtctcc
agtttacctggtgccattattcaacgagcgagcccgggactctatgacatgctgactaac
ggtgttctccaggcaaatgtcgcatttgataaggccatgtttaactgccaaaacatgact
aaacggatgatggatttttcggattccagcaaatggacgcaatccgcacaggcagatgaa
tacaagcaactggttaatagcggaaaagcggacgccattcaaacggataacgactcccaa
aaactgactggcaataacggccaaaattggattggtggtcagcgacgtggcggtaaaggg
cagccagctattcgcccaacacacgatttggccgcagccggttataacatgatgaatagc
cagccggcgttgagtacatcttccgtcagtaccagcaattgcactggctcagtctgtcag
aaattccctaactcggaggaagccgcaaaagctgtcgtccaggtgcttggcgatcgctcg
atgcggacgtgtaaggttgccactgactgcaccagtggggatgaaggccaacaacccgga
actactcaggcgggaaccgggtttgcccccatgttggaagaggcaacgaaagccaatctt
gaacaactggtgaaaatggttaatggggcagagaaacctaccgcggcgaacctgggcaaa
ttgaaagctgggagcctgactatcaccagtggtgttatccgggcattacaacgtgatcca
gataacgctgcattgactggtcggttggccagcgaactggcgatggcggatacggtcgag
acggccttactgatgcgacgcatgctgatgaccggaatgtctgagccaaatgctgccgct
caggaggctgcggttgatgagggaactcgtcgtattgaatcgctcgatcgggaaattaat
gcgctaaagaatgagatggaactcaaacgcgagctggcacgtaactcggtactgaccatc
attgagcgggaaaatagccgcgtagaaaccaatccgcagaagcaaatccaggacaacacg
gatatgcgcgtcaatcagatgactacccctgttcagggtaaataa

DBGET integrated database retrieval system