KEGG   Pectobacterium atrosepticum SCRI1043: ECA0580
Entry
ECA0580           CDS       T00186                                 

Definition
(GenBank) putative membrane protein
Organism
eca  Pectobacterium atrosepticum SCRI1043
SSDB
Motif
Pfam: TraG_N
Other DBs
NCBI-ProteinID: CAG73495
GeneDB: ECA0580
UniProt: Q6D9N5
Position
642505..644037
AA seq 510 aa
MTTNSYFEYFLTLLGWVINNGLWNILIGTGLFAAPLAFKIVGIWMKVREEGEDEGNKGML
SLPRIENALYGGFFVMLACCVPLINLSLSTMQYDTSRAKTCGTWTPLSPDESGYSSVVSS
LNDQTAAVPFWWAVVHRLSKGVTQAAVATIPCRPDLRQVRFEVQRTNISNPALAEELQDF
TNDCYALALYTWKQQDQGATTDKDVLKDIEWLGSSTFRSRYYGELNSKMPRSNFPWSDAR
DSGRPNTGRGGYPTCNEWWSTADTGLQDRVVNQADPGMWLRLSAALKMMGKSTADYKEAV
IRRLVSPQSLNISQGGQVYAGYGGNADFTTMNTVNRFGAIAGGALGSLGAFPAFDAMRQA
LPMVQAILLMAIYVMLPLILAFGVYEFKVVITLTFVIFALNFLTFWWELARWLDSWLLEA
LYSSDTHSRFNLAGFQNTSDDLVMTFVMGTMFIVLPAVWVGSLSWAGRDIGAALSNAIGS
GVKDARVSASSAGDAASGAIKQAATNRLSK
NT seq 1533 nt   +upstreamnt  +downstreamnt
atgaccacaaacagctatttcgagtattttctgacgctactgggttgggtcattaataat
ggcctgtggaacatcctgattggtaccggactatttgctgcacctttggcctttaaaata
gttggtatttggatgaaggtccgagaagaaggagaggacgaaggaaacaaaggaatgcta
tcgctaccccgcatcgaaaacgcactgtacggtgggttctttgtgatgttggcctgctgc
gttccgttgattaatttgagcctgagtaccatgcagtacgatacgtctcgagcgaaaacg
tgtggaacctggacaccattgtctccggatgaaagtgggtattcgagcgtagtgtccagc
cttaatgatcagactgctgcggtacccttttggtgggccgttgtacaccgcctgtcaaaa
ggggtaacacaggctgccgtcgcgaccattccttgtcgcccggatttgcgccaggttcgt
tttgaggtgcagagaaccaatatcagcaatccggcgttggctgaagagcttcaggacttt
accaacgactgttatgcgctcgcgttatatacgtggaaacagcaagatcagggagccaca
acggataaggatgtgctgaaggacattgaatggttaggcagttcaacgtttcgttcccgt
tattatggtgaactgaactcaaaaatgccgcggtcaaattttccctggagcgatgccagg
gacagtgggcggccgaatacggggcggggggggtatcctacatgtaatgaatggtggtcc
acagcggataccggtttgcaggatagggtagtcaatcaagctgacccaggcatgtggctg
cgtctttctgccgcactgaaaatgatggggaaaagcacggctgactacaaagaagcagtg
atcaggcgactggtgagtcctcagagcctaaatatctctcagggagggcaggtttatgcg
ggctacggaggtaatgcggacttcaccacgatgaataccgtcaatcggtttggtgctatt
gccggcggcgcgttgggaagcctgggagcatttccggcatttgatgcgatgcgccaggcg
ctaccaatggttcaggctattttattgatggctatctacgtcatgttgccgctgatcctt
gcgtttggtgtctatgaattcaaggtcgtgattaccctaacgttcgtgatattcgcgctg
aatttcctgacgttctggtgggaactggctcggtggctcgacagttggctacttgaagca
ctgtacagctcggatacccacagcagatttaatctggcagggtttcaaaacacctctgac
gacctggtcatgacttttgtgatgggaacaatgttcattgttctgccggcagtatgggta
ggatcattatcgtgggcagggcgggatatcggggctgcgttatccaacgcaataggtagt
ggagtaaaagatgctagagtttcagcaagtagtgctggtgatgctgctagtggggcaata
aaacaagcggctacaaataggttatcaaaataa

DBGET integrated database retrieval system