KEGG   Pectobacterium atrosepticum SCRI1043: ECA1113Help
Entry
ECA1113           CDS       T00186                                 

Definition
(GenBank) putative methionine synthase
  KO
K00549  5-methyltetrahydropteroyltriglutamate--homocysteine methyltransferase [EC:2.1.1.14]
Organism
eca  Pectobacterium atrosepticum SCRI1043
Pathway
eca00270  Cysteine and methionine metabolism
eca00450  Selenocompound metabolism
eca01100  Metabolic pathways
eca01110  Biosynthesis of secondary metabolites
eca01230  Biosynthesis of amino acids
Module
eca_M00017  Methionine biosynthesis, apartate => homoserine => methionine
Brite
KEGG Orthology (KO) [BR:eca00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00270 Cysteine and methionine metabolism
    ECA1113
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    ECA1113
Enzymes [BR:eca01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.14  5-methyltetrahydropteroyltriglutamate---homocysteine S-methyltransferase
     ECA1113
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Meth_synt_2
Motif
Other DBs
NCBI-ProteinID: CAG74023
GeneDB: ECA1113
UniProt: Q6D862
Position
1264025..1265131
Genome map
AA seq 368 aa AA seqDB search
MANTLSPFRADIVGSFLRPAAIKQARLQHQAGEIDDVALRNIEDREILRVVEKQREAGLQ
VVTDGELRRSWWHFDFFADLHGVERYEADHGIQFNGIQTKSHAIRVVDKVSFNPQHPMLD
HFRYLNSISGDAVAKMTIPSPSVMHFRGGRKAIDATVYPDLADYFDDLAQTWRDAIHAFY
DAGCRFLQLDDTVWAYLCSDDQKRQIRERGEDPAQLARTYADVLNKALADKPADLVIGLH
VCRGNFRSTWISEGGYEPVAEILFGEVNVDAFFLEYDTERAGGFEPLRFVKPGHQQVVLG
LITTKNGELEEAEVVQARIAEAAKYVDISQICLSPQCGFASTEEGNSLTEDQQWNKLKLV
VDIANRVW
NT seq 1107 nt NT seq  +upstreamnt  +downstreamnt
atggcgaacaccttatcccctttccgtgccgatatcgtcggcagtttcttgcgtccggct
gcaattaagcaggcacgtcttcagcaccaagcgggcgagattgatgatgtcgcgctgcgg
aatattgaagatcgtgagattctgcgggtggtagaaaagcagcgtgaagctggcttgcag
gttgtgacggacggtgagttgcgccgttcttggtggcacttcgacttctttgccgatttg
cacggcgtagagcgctatgaagccgatcacggtattcaattcaacggtattcagaccaaa
tcccatgcgatccgtgtcgtggataaagtgagttttaaccctcaacacccgatgctcgat
catttccgctacctgaacagcatttctggcgatgcagtcgctaaaatgacgattcctagc
ccgagcgtgatgcatttccgcggcggccgaaaagcgattgatgcgacggtttatcccgat
ttggctgattacttcgacgatctggcgcaaacctggcgcgatgcgattcacgcattttat
gatgcgggctgccgcttcctgcaattggatgacaccgtgtgggcttacctgtgctctgac
gatcaaaaacgtcagatccgtgagcgtggtgaagatccagcacagttggcacgtacctat
gccgatgtcctgaataaagcactggctgataaacctgccgatctggttatcggtttacac
gtttgtcgtggtaatttccgttcgacctggatttctgaaggtggatatgagcctgttgca
gaaattctgtttggtgaagtgaatgtcgatgcattcttcctggaatatgataccgagcga
gcaggcggatttgagccactgcgttttgtgaagccgggtcaccagcaggttgtgttgggg
ctgatcactacgaagaacggcgagctggaagaggctgaggtcgtgcaagcgcgtatcgcg
gaagcggcaaagtatgtcgatatcagccagatttgcctgagtccgcagtgtggctttgct
tcaacggaagagggcaacagcctgacggaagatcagcagtggaataagctgaagcttgtt
gtggatatcgccaatcgcgtgtggtga

DBGET integrated database retrieval system