KEGG   Pectobacterium atrosepticum SCRI1043: ECA1282Help
Entry
ECA1282           CDS       T00186                                 

Gene name
atoB
Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
eca  Pectobacterium atrosepticum SCRI1043
Pathway
eca00071  Fatty acid degradation
eca00280  Valine, leucine and isoleucine degradation
eca00310  Lysine degradation
eca00362  Benzoate degradation
eca00380  Tryptophan metabolism
eca00620  Pyruvate metabolism
eca00630  Glyoxylate and dicarboxylate metabolism
eca00640  Propanoate metabolism
eca00650  Butanoate metabolism
eca00900  Terpenoid backbone biosynthesis
eca01100  Metabolic pathways
eca01110  Biosynthesis of secondary metabolites
eca01120  Microbial metabolism in diverse environments
eca01130  Biosynthesis of antibiotics
eca01200  Carbon metabolism
eca01212  Fatty acid metabolism
eca02020  Two-component system
Brite
KEGG Orthology (KO) [BR:eca00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    ECA1282 (atoB)
   00630 Glyoxylate and dicarboxylate metabolism
    ECA1282 (atoB)
   00640 Propanoate metabolism
    ECA1282 (atoB)
   00650 Butanoate metabolism
    ECA1282 (atoB)
  09103 Lipid metabolism
   00071 Fatty acid degradation
    ECA1282 (atoB)
   00072 Synthesis and degradation of ketone bodies
    ECA1282 (atoB)
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    ECA1282 (atoB)
   00310 Lysine degradation
    ECA1282 (atoB)
   00380 Tryptophan metabolism
    ECA1282 (atoB)
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    ECA1282 (atoB)
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    ECA1282 (atoB)
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    ECA1282 (atoB)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:eca04147]
    ECA1282 (atoB)
Enzymes [BR:eca01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     ECA1282 (atoB)
Exosome [BR:eca04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   ECA1282 (atoB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt
Motif
Other DBs
NCBI-ProteinID: CAG74192
GeneDB: ECA1282
UniProt: Q6D7P3
Position
complement(1457257..1458435)
Genome map
AA seq 392 aa AA seqDB search
MNDSIVIVNAKRTAIGKFAGSLANTSAIDMASATIRDCLSTLPDTLAIDEVILGNVLQAG
LGQNPAHQASKAAGLPFETPSLTISKVCGSGLKAVVMGAQSILSGDNQVCVTGGMENMSA
APYLLEKARHGYRMGDGKLVDIMIKDGLWCAFNDYHMGTTAENIAERYQLTREEQDQVAL
ASQQKAVAAIEAGRFKAEITPLSLRSKKETRIFDRDEFPRADTTLASLAALRPAFSANGT
VTAGNASGINDAAATLVLMRESEAKKQGITPLARIRSWASAGVPSEVMGLGPIPATQKAL
LKAGLTIGDIDLIEANEAFAAQFLAVQRDLHLDPEKVNVNGGAIALGHPIGASGARILVT
LVHALHSYNKTLGLATLCIGGGQGIAMIVERV
NT seq 1179 nt NT seq  +upstreamnt  +downstreamnt
atgaacgactccattgttattgttaatgccaagcgcaccgcgattggtaaattcgcaggc
agtctggccaacacatcggctatcgacatggcatctgccaccatccgtgactgcctgtcg
acgctgccggacacgctggcgattgatgaagtgattctcggcaacgtgctgcaagccggt
ctggggcaaaaccccgcgcatcaggccagcaaggctgctgggctgccttttgaaacaccc
tcgctcaccatcagtaaggtgtgtggttccggcctgaaggccgttgtgatgggcgcacag
tctattctgtccggcgataatcaggtctgcgtgaccggcgggatggaaaacatgagcgcc
gcgccttacctgctggaaaaagcgcgccacggttaccgcatgggagacggcaagctcgtt
gacatcatgattaaggatggtctgtggtgtgcgtttaacgattaccacatgggtaccacg
gcggaaaatatcgccgagcgctaccagctcacgcgagaagaacaggatcaggtggcgctg
gcatcacagcagaaagccgtcgccgcgattgaggctggccgcttcaaagccgaaataacc
ccgctgtcactgcgtagcaaaaaagagacgcggattttcgatcgggatgaattccctcgc
gccgacaccacgctggcatcgctggccgcgttacgtccggcgttttccgctaacggcacc
gtcaccgcaggcaatgcgtccggcattaacgatgccgccgcgacgctggtgttaatgcgt
gaatccgaagcgaaaaaacagggtattaccccgctggcgcggatccgcagttgggcgtct
gctggagtaccgagtgaagtgatggggctggggccgattccggcgacgcagaaagcactg
ctcaaggctgggctgacgatcggtgatattgacctgattgaagcaaatgaagcttttgcc
gcacagtttctagcggtacagcgcgatcttcatctcgatccagagaaagtgaacgtcaac
ggcggtgcgattgcgttgggccaccctatcggcgcgagcggtgcgcgtattctcgtcacg
ctggtacatgcgctgcacagctataacaaaacgctgggattggcgacgctgtgcatcggc
ggtgggcaaggtatcgcgatgatcgtcgaacgcgtttaa

DBGET integrated database retrieval system