KEGG   Pectobacterium atrosepticum SCRI1043: ECA1325Help
Entry
ECA1325           CDS       T00186                                 

Gene name
nagA
Definition
(GenBank) N-acetylglucosamine-6-phosphate deacetylase
  KO
K01443  N-acetylglucosamine-6-phosphate deacetylase [EC:3.5.1.25]
Organism
eca  Pectobacterium atrosepticum SCRI1043
Pathway
eca00520  Amino sugar and nucleotide sugar metabolism
eca01100  Metabolic pathways
eca01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:eca00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    ECA1325 (nagA)
Enzymes [BR:eca01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.25  N-acetylglucosamine-6-phosphate deacetylase
     ECA1325 (nagA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Amidohydro_1 Amidohydro_3
Motif
Other DBs
NCBI-ProteinID: CAG74235
GeneDB: ECA1325
UniProt: Q6D7K0
Position
complement(1500630..1501778)
Genome map
AA seq 382 aa AA seqDB search
MMYALTHSRIFTGHQILDNHAVVIANGLIERICSVAELPAGIEQHDLSGAFLAPGFIDLQ
LNGCGGVQFNDSLDTISVKTLEIMQQANQRSGCTSFLPTLITSSDEFMKHSINVMRDWLA
QNKHQALGLHLEGPWLNVIKKGTHDPAFIRKPTQALVDFLCVNADAITKITLAPEEVEPA
VIRQLTAAGIIVSAGHSNATWEQAKQGFSAGIRFATHLFNAMPYLTGREPGLVGAIYDAP
EVYCGIIADGRHVDWANIRNSKRIKGDKLVLVTDATAPAGADIDQFIFAGKTIYYRDGIC
VDEHGTLSGSALTMIDAVRNSVEHAGIALDEAIRMATLYPARAIGVDKQLGSIESGKVAN
LTAFDRDYHILKTFVNGNPVWG
NT seq 1149 nt NT seq  +upstreamnt  +downstreamnt
atgatgtacgcgttaacccatagccggattttcaccggccatcagattctggataatcac
gccgtcgtgattgccaatgggctgatcgagcgaatctgctcggttgctgagctccctgcc
ggcattgaacaacacgacctgagcggtgcgtttctcgctccaggatttatcgatctccaa
ctgaacggctgcggcggtgtgcaatttaacgactcgctggacacgatctccgtcaaaacg
ctggagatcatgcagcaggcgaaccagcgttcaggctgtaccagttttttacccacgctg
attacctccagcgatgagtttatgaaacacagcatcaacgtaatgagagactggctggcg
cagaataagcatcaggcgcttggactacatctcgaaggcccgtggctaaacgtgataaaa
aaaggcacacatgaccctgcctttatccgcaagccaacgcaagcgctcgtcgattttctg
tgtgtcaacgcagatgccattacgaaaatcacgctggcaccggaagaagtcgaaccggca
gttatccgccagttaacggcggcgggcattatcgtctccgccggacactctaacgcgacc
tgggaacaggctaagcagggtttttccgctggcattcgcttcgccactcacctgttcaac
gcaatgccatatctgactggccgtgaacccgggctagtcggcgcaatttacgatgccccg
gaagtctattgcggcattatcgcggatggacgtcacgtagactgggccaatattcgcaac
agcaagcgcattaagggcgataaactggtgctggtgaccgacgccacagcaccagcgggc
gcagatattgaccagttcatttttgctggtaaaaccatatactaccgtgatggcatttgt
gtcgatgaacacggcaccctaagcggctctgcactgacaatgatcgacgccgtgcgtaat
agcgtcgaacacgctggaatcgcactggatgaagctattcggatggcaacgctctatccg
gctcgtgccatcggcgtcgataagcagttaggcagcattgaaagcggtaaagtggctaat
ctgaccgcatttgaccgtgattatcacattctcaagacgtttgttaacggtaatcctgtt
tggggataa

DBGET integrated database retrieval system