KEGG   Pectobacterium atrosepticum SCRI1043: ECA1616
Entry
ECA1616           CDS       T00186                                 

Gene name
virB8
Definition
(GenBank) putative conjugal transfer protein
  KO
K03203  type IV secretion system protein VirB8
Organism
eca  Pectobacterium atrosepticum SCRI1043
Pathway
eca03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:eca00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    ECA1616 (virB8)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:eca02044]
    ECA1616 (virB8)
Secretion system [BR:eca02044]
 Type IV secretion system
  Conjugal DNA-protein transfer (VirB/D) protein
   ECA1616 (virB8)
SSDB
Motif
Pfam: VirB8 Oxidored_q3
Other DBs
NCBI-ProteinID: CAG74520
GeneDB: ECA1616
UniProt: Q6D6R5
Position
complement(1871087..1871770)
AA seq 227 aa
MPDVQKIINASRSFESIMLEKEERTRKTAWAMAAVGFTLAGLAIAAVIILLPLKTTEIEL
WSVDKQTGRYEYMTRIKERDISTEEALAHSLAAHYVTLREGYNYFSLQRDYDDVQLFNSD
SVNKEYLDGFNGDQAPDVIFHKADYVVSVDTISNVHAPATAPDRLATLRIKRTLRRIADN
SVKTDFWNIRLTWRYLPRKQLTDSQREVNPLGFIVTSYQRDKELRSE
NT seq 684 nt   +upstreamnt  +downstreamnt
atgcctgacgttcagaaaatcatcaatgcatcccgctcatttgaatccatcatgctggaa
aaggaggagcgtaccaggaagactgcatgggctatggcggcggtcggatttacgctggcc
ggactggcgatagccgccgtgattattctgctgccgctgaaaaccaccgaaatcgaatta
tggtcagtggataaacagaccgggcgctatgaatacatgacccgcattaaagagcgggat
atttccaccgaggaagcgctggcgcattcgctggcggcgcattacgtcaccctgcgcgaa
gggtataactatttttctcttcagcgcgattacgatgacgtgcagttattcaacagcgac
agcgtcaataaagagtatctggacggatttaacggtgaccaggcaccggatgtcattttc
cataaggcggactatgtcgtttctgtcgacactatttccaacgtccatgctcccgcaacg
gctcccgatcgcctggccaccctgcggattaagcgcacccttcgccgcattgcagataat
tcggtaaaaacggatttctggaatatccgcctgacctggcgctaccttccccgcaaacag
ctgacggacagtcagcgagaagtgaacccgctggggttcattgtcaccagttaccagcgc
gataaagaactgaggagcgaatga

DBGET integrated database retrieval system