KEGG   Pectobacterium atrosepticum SCRI1043: ECA1993
Entry
ECA1993           CDS       T00186                                 

Gene name
zntB
Definition
(GenBank) zinc transport protein
  KO
K16074  zinc transporter
Organism
eca  Pectobacterium atrosepticum SCRI1043
Brite
KEGG Orthology (KO) [BR:eca00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:eca02000]
    ECA1993 (zntB)
Transporters [BR:eca02000]
 Other transporters
  Pores ion channels [TC:1]
   ECA1993 (zntB)
SSDB
Motif
Pfam: CorA
Other DBs
NCBI-ProteinID: CAG74894
GeneDB: ECA1993
UniProt: Q6D5P8
Position
2261346..2262329
AA seq 327 aa
MESFAGKELQHSGAVHAYQLDGKGGITPIGEQDVVNSEKPCWLHLDSTVPASARWLNKTL
VVPDSVRTALAGESVRPRVTRLGEGTLITLRSINLNANARPDQLVAVRVFITDKLIISTR
RRKILAIDEILTDLKEGNGPTDSGNWLVSIAEALTDHTSEFIDDLHEKIIDLEDDLLEQK
IPPRGELALIRKQLIVLRRYMTPQRDVFSRISGEKLPWMQDDDRRRMQEIADRLGRGLED
LDASVARTTVLSDEITALMTEAMNRRTYTMSLLAMVFLPTTFLTGLFGVNLGGIPGGDAP
FGFFTFCLMLVILVGGVAWWLKRSKWL
NT seq 984 nt   +upstreamnt  +downstreamnt
gtggaatcctttgcaggaaaagagttgcaacatagcggtgcggttcatgcgtatcagttg
gatggaaaggggggcattaccccgattggcgagcaagacgttgtcaacagcgagaaaccc
tgctggctacacctagattctacagtgccagctagcgcacgctggctgaataaaacgcta
gtggtacccgatagcgtacgcactgcgttggcgggggaaagcgtccgccccagagttacg
cgtttgggcgaaggtacgctgatcacgctgcgcagcattaacctgaatgccaatgcgcgg
ccagatcaactcgtggccgttcgggtgttcattaccgacaagctgattatctctactcga
cgccgtaagattctggctatcgatgagattcttaccgacctgaaagaaggcaatggcccg
acggacagcggaaactggctggtctccattgcggaagccttgaccgatcataccagcgag
ttcattgatgatttgcatgagaaaatcatcgatctggaagacgatttgctggaacaaaag
attccgccgcgcggcgagctggcgctgattcgcaaacagcttatcgtgctacgccgctat
atgacgccacagcgcgatgtattctcgcgtatttccggcgagaagctgccttggatgcag
gatgacgaccgacgcagaatgcaggaaattgccgatcggttagggcgcgggttggaggat
ttggatgccagtgttgctcgcaccacggtactttcggatgaaatcaccgccttgatgacc
gaagcgatgaaccgccgtacctatacgatgtcgcttttggcgatggtttttctgccaacg
acgttcttaaccggtttatttggcgtcaatttagggggaattcccggcggcgatgcgccg
tttggttttttcacgttctgcctgatgttggtgatattggttggcggcgttgcatggtgg
ttaaagcgcagtaaatggctatag

DBGET integrated database retrieval system