KEGG   Pectobacterium atrosepticum SCRI1043: ECA2018Help
Entry
ECA2018           CDS       T00186                                 

Definition
(GenBank) probable short-chain dehydrogenase
  KO
K13938  dihydromonapterin reductase / dihydrofolate reductase [EC:1.5.1.50 1.5.1.3]
Organism
eca  Pectobacterium atrosepticum SCRI1043
Pathway
eca00670  One carbon pool by folate
eca00790  Folate biosynthesis
eca01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:eca00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    ECA2018
   00670 One carbon pool by folate
    ECA2018
Enzymes [BR:eca01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.3  dihydrofolate reductase
     ECA2018
    1.5.1.50  dihydromonapterin reductase
     ECA2018
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: adh_short_C2 adh_short KR Epimerase Exostosin
Motif
Other DBs
NCBI-ProteinID: CAG74919
GeneDB: ECA2018
UniProt: Q6D5M3
Position
complement(2290679..2291401)
Genome map
AA seq 240 aa AA seqDB search
MTTFSSAPVLITGGARRIGLALARSFLAQSIPVIISYRTPYPELDTLEQDGAVCLAADFS
TTESIYAFAEKIQSLTPQLRAIIHNASRWEPENPATPPEQTLADMLQIHVYTPYLLNQLL
EPCLRGQGIAGADIIHLTDYVVEKGSEKHIAYAASKAALDNMTRSFARKLAPEVKVNAIA
PSLILFKEQDDDAYRQQALEKSLMKIAPGEEEIVRLVDYLFSSRYITGKTLGVDGGRALR
NT seq 723 nt NT seq  +upstreamnt  +downstreamnt
gtgacaactttttcttctgctcccgtgttaattaccggcggcgcgcgacgtattggtctg
gcgctggcacgttcgtttttggcccagtcgattcccgtcattattagctatcgcacgcct
tatcccgaactggacacgctagagcaagacggtgctgtttgtctggctgccgacttttcc
accacggaaagcatctatgcgtttgctgagaaaatccaatcactcacgccgcagctacgc
gccattattcacaacgccagccgctgggagccagaaaaccccgcaacaccgccagaacag
acgctggccgatatgctacaaattcatgtctatacgccctatttgctcaaccaactgcta
gagccttgcctgcgtgggcaaggcattgctggcgcggatattattcatctgacggattac
gtagttgaaaaaggcagcgagaaacacatcgcctatgctgccagcaaagcggcgttggat
aacatgacgcggtcgtttgcccgtaagctggcaccggaagtgaaggtcaacgctattgct
cccagcttaattctgtttaaggaacaggatgacgacgcatatcgccagcaggcgctggaa
aagtcgttgatgaaaatcgcgcccggcgaagaggaaattgtccgactggtggattaccta
ttcagcagccgctacatcacggggaaaacgttgggcgttgatggcggacgcgcgttgcgc
taa

DBGET integrated database retrieval system