KEGG   Pectobacterium atrosepticum SCRI1043: ECA2644Help
Entry
ECA2644           CDS       T00186                                 

Gene name
serS
Definition
(GenBank) seryl-tRNA synthetase
  KO
K01875  seryl-tRNA synthetase [EC:6.1.1.11]
Organism
eca  Pectobacterium atrosepticum SCRI1043
Pathway
eca00970  Aminoacyl-tRNA biosynthesis
Brite
KEGG Orthology (KO) [BR:eca00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    ECA2644 (serS)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:eca01007]
    ECA2644 (serS)
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:eca03016]
    ECA2644 (serS)
Enzymes [BR:eca01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.11  serine---tRNA ligase
     ECA2644 (serS)
Amino acid related enzymes [BR:eca01007]
 Aminoacyl-tRNA synthetase
  Class II (C/G)
   ECA2644 (serS)
Transfer RNA biogenesis [BR:eca03016]
 Eukaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Other AARSs
    ECA2644 (serS)
 Prokaryotic type
    ECA2644 (serS)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: tRNA-synt_2b Seryl_tRNA_N Troponin Spc7 UPF0242 Phage_GP20 USP8_interact FlaC_arch Bacillus_HBL
Motif
Other DBs
NCBI-ProteinID: CAG75544
GeneDB: ECA2644
UniProt: Q6D3V0
Position
complement(2974318..2975613)
Genome map
AA seq 431 aa AA seqDB search
MLDPNLLRNELDAVAEKLLARRGFKLDVETLRKQEERRKVLQVETESLQAERNSRSKEIG
AAKARGEDIEPLRREVNTLGEKLDTAKAELDQLQNEIRDLALTIPNLPDDSVPLGKDESQ
NKEVTRWGEPRKYDFAVRDHVELGEMAGGLDFAAAVKLTGARFVVMKGQIARLHRALAQF
MLDLHTQQHGYQEAYVPYLVNHATLYGTGQLPKFGEDLFHTNPLSEEAESSQYALIPTAE
VPLTNLVRDEILDEESLPLKMTAHTPCFRSEAGSYGRDTRGLIRMHQFDKVELVQIVRPE
DSMQALEELTTHAETVLQLLKLPYRKVLLCTGDMGFGSTKTYDLEVWLPAQDTYREISSC
SNMWDFQARRMQARCRSKSDKKTRLVHTLNGSGLAVGRTLVAVLENYQQADGRIEIPEVL
RPYMGGLEFIG
NT seq 1296 nt NT seq  +upstreamnt  +downstreamnt
atgctcgatcccaatttactgcgtaatgagctagacgcagtcgccgaaaagttactggct
cgcagaggctttaagctggatgttgagaccctgcgtaagcaggaagaacgtcgtaaagta
ttgcaggtagaaaccgaaagcctgcaagcagagcgtaactcccgatcgaaagagattggt
gcagcgaaagcacgcggtgaggatatcgagcctttgcgtcgtgaagttaatacattaggc
gaaaagctggatactgcgaaagcagagctggatcagttgcagaatgagattcgcgatctg
gcgttaacgatcccgaacctgccggacgactccgtgccgcttgggaaagatgaatcacag
aacaaagaagttacccgctggggtgagccgcgtaagtatgatttcgccgtgcgcgatcat
gttgaactcggcgagatggctggcggactggattttgctgctgcggtgaaattaaccggt
gcgcgttttgtcgtgatgaaaggacagattgctcgtctgcaccgtgcgcttgcccagttc
atgctggatttgcatacacaacagcacggttatcaggaagcgtatgtgccttatctggta
aaccacgccacgttatacggtacgggccagttgcctaagtttggtgaagacctgttccac
accaatcccttaagcgaagaagcagaaagcagccaatacgcgctgatcccaactgctgaa
gtcccgctgaccaatctggtacgtgacgaaattctggatgaagaatctttaccgttgaaa
atgaccgcacacacaccttgcttccgttcagaagcgggttcgtatggtcgtgatacgcgt
ggattgattcgcatgcaccagtttgacaaggttgaactggtacaaatcgtccgtcctgag
gattccatgcaggcgctggaagagttgacgacccacgccgaaacggtgctgcaactgctt
aaattaccttatcgtaaggtattgttgtgcactggcgacatgggtttcggctccaccaaa
acttacgatctggaagtttggttgccagcgcaggacacgtatcgtgaaatttcttcctgc
tcaaacatgtgggatttccaggcgcgccgtatgcaggcccgctgccgcagcaagtccgat
aagaagactcgactggttcacacgttgaacggttctggtctggcggttggtcggacactg
gtggccgttttggaaaactatcagcaggccgatggccgcattgaaattcctgaagtactg
cgcccctatatgggcgggctggaatttattggctaa

DBGET integrated database retrieval system