KEGG   Pectobacterium atrosepticum SCRI1043: ECA3437
Entry
ECA3437           CDS       T00186                                 

Definition
(GenBank) putative membrane protein
  KO
K11892  type VI secretion system protein ImpK
Organism
eca  Pectobacterium atrosepticum SCRI1043
Pathway
eca03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:eca00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    ECA3437
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:eca02044]
    ECA3437
Secretion system [BR:eca02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   ECA3437
SSDB
Motif
Pfam: DotU
Other DBs
NCBI-ProteinID: CAG76336
GeneDB: ECA3437
UniProt: Q6D1K9
Position
complement(3854912..3855688)
AA seq 258 aa
MSIEVIKNDQLGDLLFDHARQLDMDSDYWFRLRGQSINPMVDTVTPLLGMVERVRQLSAY
EGVEDLYQRVVSEIQAIEQELHSHGYENGVILSFRYILCTFIDEAVMGREWGGQSMWSAH
SLLTRFHNETWGGEKVFVLLEKLLDDPTRYRDILEFIYLCLCLGFEGRYRVMTQGREELN
RVVSKLHDTLRPEPANSPTVFHLNLGQQASRYHLRRQVSLRTLFIGVFVVLVAAFGLYRY
ELTHQTQDVLRQLGELLQ
NT seq 777 nt   +upstreamnt  +downstreamnt
atgagcatcgaggttattaaaaacgatcaactgggcgatctgctttttgaccacgcccga
cagctggatatggactccgactactggttccgcctgcgtggacaaagcattaatccgatg
gttgatacggtcacgccgctgctgggcatggtggagcgagtacgccagctctctgcttat
gagggcgtggaggatctctatcagcgcgtggtgtctgaaattcaggccatcgagcaggaa
ttgcattctcatggctatgaaaacggcgtgattttgtccttccgctacatcctctgcacc
ttcattgatgaagccgtgatgggacgggagtggggcgggcaaagcatgtggtcggcccat
tccctgttgacccgttttcataatgagacctggggaggcgaaaaggtttttgtcctgctg
gagaagctgctggacgatcccacccgctatcgcgacattctggagtttatctacctttgc
ctctgtctgggctttgaagggcgctatcgggtgatgactcaggggcgtgaggagttgaac
cgcgtcgtgagtaagttacatgacacgctgcgccctgagcctgctaattcgccgacggtc
ttccacttgaatctggggcagcaggcctcgcgttaccacctgcgtagacaggtgtcattg
cgcacgttgtttatcggcgtttttgtggtcttggtggccgcattcggcctgtaccgttac
gagctaactcatcaaacccaggacgtactgcgtcagctgggagaattattacaataa

DBGET integrated database retrieval system