KEGG   Pectobacterium atrosepticum SCRI1043: ECA3439
Entry
ECA3439           CDS       T00186                                 

Definition
(GenBank) putative lipoprotein
  KO
K11906  type VI secretion system protein VasD
Organism
eca  Pectobacterium atrosepticum SCRI1043
Pathway
eca03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:eca00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    ECA3439
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:eca02044]
    ECA3439
Secretion system [BR:eca02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   ECA3439
SSDB
Motif
Pfam: T6SS-SciN LPAM_1
Other DBs
NCBI-ProteinID: CAG76338
GeneDB: ECA3439
UniProt: Q6D1K7
Position
complement(3857044..3857565)
AA seq 173 aa
MLRALCLFSLMLLLSGCSTLGKMAQVAANPDIQVGSNNHQPSTVGFSLLAEPDVNPNDSG
EAAPIEFQLVLLAEDSRLLATDYDQITTDIEKALAKNYISHQDYTLLPGQFKYLPPEALD
EKVHYLGVVARYADSESAEWRKVIKLKNTGQTYQILVHLRRDEVEIKKDQEEE
NT seq 522 nt   +upstreamnt  +downstreamnt
atgctgcgggcactgtgcttattttccctgatgttactgctgtcggggtgttccacgctg
ggcaagatggcgcaggtcgcggcgaatccggatatccaggtgggcagcaacaatcatcag
ccttctaccgtggggtttagcctgctggcggaaccggatgtgaatccgaacgacagcggt
gaagccgcccctatcgaattccaactggttctgctggcggaagattcgcgtctgttagca
accgattacgaccagatcacgacggatatcgaaaaagcgttggccaagaattacatcagc
catcaggactacacgctattgccggggcagttcaaatatctgccgccagaagcactggat
gaaaaggtgcactacctcggcgtggtagctcgatatgcagattcggaaagcgcggagtgg
cgcaaagtcatcaagctaaaaaataccggacagacgtatcagatcctcgtgcacttgcgc
cgggatgaagtcgaaatcaaaaaagaccaagaagaagaataa

DBGET integrated database retrieval system