KEGG   Pectobacterium atrosepticum SCRI1043: ECA3442
Entry
ECA3442           CDS       T00186                                 

Definition
(GenBank) conserved hypothetical protein
  KO
K11896  type VI secretion system protein ImpG
Organism
eca  Pectobacterium atrosepticum SCRI1043
Brite
KEGG Orthology (KO) [BR:eca00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:eca02044]
    ECA3442
Secretion system [BR:eca02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   ECA3442
SSDB
Motif
Pfam: T6SS_TssF DUF3828
Other DBs
NCBI-ProteinID: CAG76341
GeneDB: ECA3442
UniProt: Q6D1K4
Position
complement(3859750..3861516)
AA seq 588 aa
MSLEHFFRDELTYLRLQGREFAKAHPELTRFLSEQTTDPDVERLLEGFAFLTGSLRAKIE
DEFPELTHGLLGMLWPNYLRPVPSMTIMQFSVHPGAIAQPAFVARGCELDSLPIDDVVCH
FQTCHDAWIYPADIREIKVQSGNDLSTITLDIGLHGPLSLSDLQLDKLRFYLGGDTYTAY
ELYFWIASQLSHIELEVDGQRFRQEASVLKTVGFEREDALLPYPGNVYSGYRILQEYFCF
PESFLFFQLAGAVWPDLPLTVTEFRLHFCFDRPLPAELKIRPDSFMFNCVPAINLFQHDS
EPINLSGRQTDYPLKASYRNADSFEIFSVDKVEGWVEGNSGRSRGIPRTYQPFESFQHQI
ERAKGRLALYYRIRVREAINGNGFDHMLSFVRGDEQEVIDLDESISVTLTCTNRSRAAQL
SVGAICVPTGNSPSFATFRNLVRPTRPLRPAMDGSLHWTLISNLSLNYVSLLRRDALVQI
LRTYDFPALHDKQAEQASRKRLAGIESIETTPIDRLVQGMPVRGLKSILSVRQSAFSSEG
ELYLFSTVLAHFFSLYASVNAFHLLEVVNIDNKERYRWPVQIGQHSMM
NT seq 1767 nt   +upstreamnt  +downstreamnt
atgtcactggaacattttttcagggatgagctgacctacttgcgcctgcaagggcgtgaa
ttcgccaaggcgcaccctgagcttacccgatttttgtcagaacaaactacggatccagac
gtcgaacgtctgctggaagggttcgcctttttgacagggagcctgcgggcgaagatcgag
gatgaatttccggaactgacacatggtctgctaggcatgctgtggcctaattacctgcgc
cccgtaccaagcatgacaattatgcagttttcggtacaccccggtgcgattgcccaacct
gcgtttgtggcgcgaggctgtgagcttgatagcctgccgattgacgatgtagtttgccat
tttcagacctgccacgatgcctggatttatccggcagatatccgcgagatcaaggtacaa
agcggcaacgatctttccactattactctggatattgggctgcatggcccgctatcactc
agcgatctgcaactcgacaaactgcgcttttatctgggcggtgatacctataccgcctac
gagctctatttctggatcgctagccaactgtcgcatattgagctggaagttgatggccaa
cgtttccgtcaggaagctagcgtgctgaagacggtcggctttgagcgtgaagatgccctg
ttgccgtatcccggcaatgtctattcgggctaccgcattttgcaggaatacttttgtttt
cctgaaagttttctctttttccaacttgctggcgcggtatggcctgatctcccgctaacg
gtaacggaatttcgtctgcatttttgctttgatcgcccgttgccagcggaactgaagatc
cgccctgattcgttcatgttcaactgcgtgcctgcaattaatctcttccagcatgatagc
gaaccgatcaacctcagcggacgccagaccgattacccgctgaaagccagctaccgtaac
gctgatagctttgaaattttctctgtggataaggttgaaggctgggttgaagggaattca
ggtcgttctcggggaattccacgcacgtatcagccttttgagagctttcagcaccaaatt
gagcgagccaaaggacggctggcgctctattaccgcatccgggtaagagaagccatcaat
ggtaacggttttgatcatatgctctcttttgtgcgcggtgatgagcaagaagtgattgat
ttagatgaatccatctcggtaaccctgacttgcaccaatcgatcgcgtgcggcgcagctg
tccgttggggcgatctgcgtgccaaccgggaattcaccgtctttcgcaacgtttcgtaat
ttggttcgcccgacgcggccgctgcggccagcgatggatggcagcctgcattggacgctg
atctccaacctgtccttgaactacgtgtcgttgctgcggcgtgatgcgttggtacagatt
ctgcgtacctacgatttccccgcgctgcacgataagcaggcagagcaagcctcgcgtaag
cgtctggcgggtatcgagtctatcgaaaccacccctatcgatcgtctggttcagggcatg
ccggtgcgcggcttgaaatcaatcctgtcggtacggcaatccgcgttttccagtgaagga
gaactctatctgtttagtacggtgctggcgcactttttctcgctatacgccagcgttaac
gctttccacctgttggaagtggtcaacatcgataacaaggagcgctaccgatggccggta
cagataggtcaacactcaatgatgtga

DBGET integrated database retrieval system