KEGG   Pectobacterium atrosepticum SCRI1043: ECA3631Help
Entry
ECA3631           CDS       T00186                                 

Definition
(GenBank) Ham1 protein homolog
  KO
K02428  XTP/dITP diphosphohydrolase [EC:3.6.1.66]
Organism
eca  Pectobacterium atrosepticum SCRI1043
Pathway
eca00230  Purine metabolism
Brite
KEGG Orthology (KO) [BR:eca00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    ECA3631
Enzymes [BR:eca01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.1  In phosphorus-containing anhydrides
    3.6.1.66  XTP/dITP diphosphatase
     ECA3631
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ham1p_like
Motif
Other DBs
NCBI-ProteinID: CAG76529
GeneDB: ECA3631
UniProt: Q6D117
Position
4079441..4080034
Genome map
AA seq 197 aa AA seqDB search
MQKVVLATGNPGKVRELASLLADFGLDIVAQTELGVDSAEETGLTFIENAILKARHAAQI
TGLPAIADDSGLAVDALGGAPGIYSARYAGAEASDQQNLDKLLLTVKDVPDEQRRASFHC
VLVYLRHAEDPTPIVCHGSWQGVLTHQSSGSGGFGYDPIFFVPELGKTAAELTREEKNAQ
SHRGQALRLLLDALRNA
NT seq 594 nt NT seq  +upstreamnt  +downstreamnt
atgcaaaaagtggttttggctaccggaaaccccggtaaagtgcgcgagctcgccagcttg
ctggccgatttcggtctggatattgtggctcaaaccgagctgggcgtggattccgccgaa
gaaaccggcctgaccttcatcgaaaacgccattctgaaagcacgtcatgcggcgcaaatc
acgggattgccggccattgccgatgattctggtctggctgtcgatgcgctgggcggcgcg
ccgggcatttactcagcacgctacgcgggcgcagaggccagcgaccagcaaaatctggat
aagctgctgctgacagtaaaagacgtaccggatgaacaacgccgcgccagcttccactgc
gtgctggtatatctgcgccacgctgaagacccgacaccgattgtctgccacggaagttgg
cagggagtgctgacacaccaatcctctggcagcggtggttttggctacgatcccatcttc
ttcgtgcctgagctgggtaaaacggcagcagaattaacacgtgaagaaaagaacgcacag
tcccatcgtggtcaggcgctacgcctgctgttggatgcgctacgcaatgcttaa

DBGET integrated database retrieval system