KEGG   Pectobacterium atrosepticum SCRI1043: ECA3760Help
Entry
ECA3760           CDS       T00186                                 

Definition
(GenBank) PdxA-like protein
  KO
K22024  4-phospho-D-threonate 3-dehydrogenase / 4-phospho-D-erythronate 3-dehydrogenase [EC:1.1.1.408 1.1.1.409]
Organism
eca  Pectobacterium atrosepticum SCRI1043
Brite
KEGG Orthology (KO) [BR:eca00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    ECA3760
Enzymes [BR:eca01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.408  4-phospho-D-threonate 3-dehydrogenase
     ECA3760
    1.1.1.409  4-phospho-D-erythronate 3-dehydrogenase
     ECA3760
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PdxA
Motif
Other DBs
NCBI-ProteinID: CAG76659
GeneDB: ECA3760
UniProt: Q6D0N8
Position
complement(4199670..4200650)
Genome map
AA seq 326 aa AA seqDB search
MSKIIAVTMGDPAGIGPEIIIKSLAEGELSGASAVVVGCVQTMRRILALNVVPTVELKII
DKPADAVFAPGVINIIDEPLEDPQALKPGIVQAQAGDLAYRCIKKATALAMAGEVHAIAT
APLNKEALHSAGHLYPGHTELLAKLTNSRDYAMVLYTDKLKVIHVSTHIALRKFLDTLNR
DRVETVIEMADVFLKRVGFTHPRIAVAGVNPHAGENGLFGDEEIKIVSPSVEAMKAKGID
VYGPCPPDTVYLQAYEGQYDMVVAMYHDQGHIPLKLLGFYDGVNITAGLPFIRTSADHGT
AFDIAWTGKAKPESMAISIQLAMQLA
NT seq 981 nt NT seq  +upstreamnt  +downstreamnt
gtgagtaaaattattgcggtaacgatgggggatccggcagggattggaccggaaattatt
atcaaatctctggccgaaggcgagctttccggcgcatccgctgtggtggtgggctgcgta
cagacgatgcgacgcattctggcgctgaacgtggtgccaacagtcgagctgaaaatcatt
gataaaccggctgacgcggtatttgcgccgggcgtcatcaacatcattgatgaaccgttg
gaagatccgcaggcgctaaagccgggtatcgttcaggcacaggcgggcgatttggcttac
cgctgcatcaagaaagcgaccgcgctggcgatggcgggtgaagtccacgcgattgcgacc
gcaccgctgaataaagaagcgctgcactcggcgggccatctttatccgggccacaccgaa
ctgctggcgaagctgaccaacagccgtgactatgcgatggtgctgtataccgataagttg
aaggttatccatgtttcaacgcacatcgcgctgcgtaaattcctggatacgctgaaccgc
gatcgcgtggaaacggtgatcgagatggcagatgtcttcctcaaacgcgtcggttttacc
catccgcgtatcgccgttgccggagttaacccgcatgcgggtgagaatggcctatttggt
gacgaagagatcaagatcgtgtcgccgtcggttgaagcgatgaaagccaaaggcattgat
gtttatggcccgtgcccgccggataccgtctatttgcaggcgtatgaaggccagtacgat
atggtggtggcgatgtatcacgatcaggggcacatcccgctcaagctactaggcttttat
gatggcgtgaatattactgctgggttgccgtttatccgcacgtcggctgaccacggtacg
gcgtttgacattgcctggacgggtaaagcgaagcctgaaagcatggcgatctctattcag
ctcgcgatgcaactggcctga

DBGET integrated database retrieval system