KEGG   Pectobacterium atrosepticum SCRI1043: ECA3788Help
Entry
ECA3788           CDS       T00186                                 

Gene name
aceF
Definition
(GenBank) dihydrolipoamide acetyltransferase component of pyruvate dehydrogenase complex
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
eca  Pectobacterium atrosepticum SCRI1043
Pathway
eca00010  Glycolysis / Gluconeogenesis
eca00020  Citrate cycle (TCA cycle)
eca00620  Pyruvate metabolism
eca01100  Metabolic pathways
eca01110  Biosynthesis of secondary metabolites
eca01120  Microbial metabolism in diverse environments
eca01130  Biosynthesis of antibiotics
eca01200  Carbon metabolism
Module
eca_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:eca00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    ECA3788 (aceF)
   00020 Citrate cycle (TCA cycle)
    ECA3788 (aceF)
   00620 Pyruvate metabolism
    ECA3788 (aceF)
Enzymes [BR:eca01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     ECA3788 (aceF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl Biotin_lipoyl_2 E3_binding RnfC_N GCV_H HlyD_D23 NQRA
Motif
Other DBs
NCBI-ProteinID: CAG76687
GeneDB: ECA3788
UniProt: Q6D0L0
Position
complement(4232027..4233904)
Genome map
AA seq 625 aa AA seqDB search
MAIEINVPDIGADEVEVTEVLVKVGDKVEAEQSLITVEGDKASMEVPSPQAGVVKEIKVS
VGDKVETGKLIMIFDSADGAADAAPAKAEEKKEAAPAAAPAASAAKEVNVPDIGGDEVEV
TEVLVKVGDTVAAEQSLITVEGDKASMEVPAPFAGTVKEIKISNGDKVSTGSLIMVFEVA
GSAPAASAEKTEAAPAAAPAASAAKEVNVPDIGGDEVEVTEVMVKVGDKIAAEQSLITVE
GDKASMEVPAPFAGTVKEIKISTGDKVKTGSLIMVFEVEGAAPAPAAKQEAAAPAPTAKS
AAAPAAKAEGKGEFAENDAYVHATPVIRRLAREFGVNLAKVKGSGRKGRILREDVQAYVK
DAVKRAEAAPTAAAGGGLPGMLPWPKVDFSKFGEVEEVELGRIQKISGANLSRNWVMIPH
VTHFDKTDITDLEAFRKQQNVEAEKRRLDVKITPVVFIMKAVAAALEQMPRFNSSLSEDA
QRLTLKKYINIGVAVDTPNGLVVPVFKDVNKKGIVELSRELMAISKKARDGKLTAGEMQG
GCFTISSLGGIGTTHFAPIVNAPEVAILGVSKSAMEPVWNGKEFTPRLMMPMSLSFDHRV
IDGADGARFITIINNTLSDIRRLVM
NT seq 1878 nt NT seq  +upstreamnt  +downstreamnt
atggctatcgaaatcaacgtaccggacatcggtgcagatgaagttgaagtcaccgaagtg
ctggtgaaggttggcgacaaagttgaagctgaacagtcgctgatcacggttgaaggtgat
aaggcttctatggaagtcccttctccgcaggcgggtgtcgtgaaagagattaaagtctct
gtcggtgacaaagttgaaaccggcaaactgatcatgattttcgattccgccgacggtgca
gctgacgctgcacctgctaaggcagaagagaagaaagaagccgctccggctgctgcacct
gcggcctccgcggcgaaagaagttaacgtaccggatatcggcggtgacgaagttgaagtg
accgaagtactggttaaagtgggcgacactgttgctgctgaacaatctctgatcactgta
gaaggcgacaaagcttctatggaagttccggcacctttcgccggtacggttaaagagatc
aaaatcagcaatggcgataaagtctctaccggttctctgatcatggtcttcgaagtggcg
ggcagcgcacctgcagcctcagcagagaaaactgaagcggcacctgctgctgcaccagcg
gcctctgcggcgaaagaagttaacgtaccagatatcggcggcgacgaagttgaagtgact
gaagtgatggttaaagtcggcgataaaatcgcggctgagcaatcactgatcaccgttgaa
ggcgacaaggcttcgatggaagtccctgcgccgtttgcgggtacggttaaagaaatcaaa
atcagcaccggcgataaagttaaaaccggctcactgatcatggtcttcgaagtcgaaggc
gctgcaccagctccggctgctaagcaggaagcggctgcaccggctccgacggcaaaatct
gctgctgcaccggcagcgaaagcggaaggcaagggcgagttcgctgagaatgacgcttac
gttcacgcgacgccggttatccgtcgtctggcacgtgaattcggcgtgaatctggcgaaa
gtgaagggttctggtcgtaaaggccgtatcctgcgcgaagacgttcaggcttacgtgaaa
gatgccgtgaaacgagctgaagctgcgccaactgctgccgctggcggcggtctgccgggc
atgctgccatggccgaaagtcgatttcagcaagtttggtgaagttgaagaagtggaactg
ggccgtatccagaaaatctctggtgctaacctgagccgtaactgggtgatgatcccgcac
gttacgcacttcgataaaactgacatcaccgatctggaagcgttccgcaaacagcagaac
gtggaagctgagaagcgcagactggatgtgaaaatcaccccagttgtcttcatcatgaaa
gccgttgctgctgcgcttgagcaaatgcctcgtttcaacagttcactgtctgaagatgct
caacgtctgacgctgaagaaatacatcaacatcggtgtagcagttgataccccgaatggt
ctggtggttccagtgttcaaagacgtgaacaagaaaggtatcgtcgaactgtctcgtgaa
ttgatggcgatctccaagaaagcacgtgacggtaagctgaccgctggcgaaatgcagggc
gggtgcttcactatctccagcctgggcggtatcgggactacgcactttgcgccgatcgtc
aatgcgccggaagttgctattcttggtgtgtctaagtccgcgatggaaccggtctggaat
ggtaaagagttcactccgcgtctgatgatgccgatgtctctctccttcgaccaccgagtc
attgacggtgctgatggtgctcgcttcattaccattattaacaatacgttgtctgacatc
cgccgtctggtgatgtaa

DBGET integrated database retrieval system