KEGG   Pectobacterium atrosepticum SCRI1043: ECA4272Help
Entry
ECA4272           CDS       T00186                                 

Gene name
tpiA
Definition
(GenBank) triosephosphate isomerase
  KO
K01803  triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
eca  Pectobacterium atrosepticum SCRI1043
Pathway
eca00010  Glycolysis / Gluconeogenesis
eca00051  Fructose and mannose metabolism
eca00562  Inositol phosphate metabolism
eca01100  Metabolic pathways
eca01110  Biosynthesis of secondary metabolites
eca01120  Microbial metabolism in diverse environments
eca01130  Biosynthesis of antibiotics
eca01200  Carbon metabolism
eca01230  Biosynthesis of amino acids
Module
eca_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
eca_M00002  Glycolysis, core module involving three-carbon compounds
eca_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:eca00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    ECA4272 (tpiA)
   00051 Fructose and mannose metabolism
    ECA4272 (tpiA)
   00562 Inositol phosphate metabolism
    ECA4272 (tpiA)
Enzymes [BR:eca01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     ECA4272 (tpiA)
Exosome [BR:eca04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   ECA4272 (tpiA)
  Exosomal proteins of bladder cancer cells
   ECA4272 (tpiA)
  Exosomal proteins of melanoma cells
   ECA4272 (tpiA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TIM
Motif
Other DBs
NCBI-ProteinID: CAG77169
GeneDB: ECA4272
UniProt: Q6CZ81
Position
4786326..4787093
Genome map
AA seq 255 aa AA seqDB search
MRHPLVMGNWKLNGSTNLVNELIAGLRKELSTVDGCGVAIAPPAIYLDQANHQLAGSRIA
LGAQNVDVNLSGAFTGETSAEMLKDIGAKYIIIGHSERRTYHKESDEFIAKKFGVLKDAG
LIPVLCIGETEAENEAGQTEAVCARQLDAVLNTLGAKAFENTVVAYEPVWAIGTGKSATP
AQAQAVHKFIRDHIAKQDAAVAEQVIIQYGGSVNAANAAELFTQPDIDGALVGGASLKAD
AFAVIVKAAADAKRG
NT seq 768 nt NT seq  +upstreamnt  +downstreamnt
atgcgacatccattagttatgggtaactggaagctgaacggcagcaccaacttggtcaac
gaattgatcgcaggcctacgtaaagagctcagcaccgttgacggttgtggcgtagccatt
gcccccccagctatctacctcgatcaggctaatcaccaactggcgggcagccgcattgca
ctgggcgcgcagaacgttgacgtgaacctttctggtgccttcaccggtgaaacgtctgcc
gagatgctgaaagatatcggtgcgaaatacatcatcattggccactctgagcgccgcacc
taccataaagaaagcgatgaattcattgcgaagaaatttggcgtgctgaaagacgcgggc
ttgattccggtgttgtgcattggtgaaactgaagctgaaaacgaagcaggccaaaccgaa
gccgtgtgcgcacgtcaactggatgccgtactgaatacgctgggtgcgaaagcgtttgaa
aacaccgttgtggcctacgaacccgtatgggctatcggcaccggtaaatctgcaactcca
gcacaggctcaggccgttcacaaattcatccgtgaccacatcgccaagcaagatgctgct
gttgctgaacaagttatcatccagtacggcggttcggttaatgctgcgaatgccgcagag
ctgttcacccagccagacatcgacggcgcgctggtcggtggtgcatcactgaaagccgac
gcttttgctgtcatcgtgaaagccgcagccgacgctaaacgcggctaa

DBGET integrated database retrieval system