KEGG   Pectobacterium atrosepticum SCRI1043: ECA4275
Entry
ECA4275           CDS       T00186                                 

Definition
(GenBank) conserved hypothetical protein
  KO
K11903  type VI secretion system secreted protein Hcp
Organism
eca  Pectobacterium atrosepticum SCRI1043
Pathway
eca03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:eca00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    ECA4275
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:eca02044]
    ECA4275
Secretion system [BR:eca02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   ECA4275
SSDB
Motif
Pfam: T6SS_HCP
Other DBs
NCBI-ProteinID: CAG77172
GeneDB: ECA4275
UniProt: Q6CZ78
Position
4790053..4790571
AA seq 172 aa
MPTPCYISIEGKTQGNITAGAFTSDSVGNIYVEGHEDEMLVQEFKHVVTVPTDPQSGQPS
GQRVHKPFKFTVALNKAVPLLYNALSTGEMLPTTTLKWYRTSVEGKQEHFFSTILTDATI
VDIDCKMPHCQDPSKLDYTQLIEVSLAYRKIDWEHTVAGTSGSDDWRAPVEA
NT seq 519 nt   +upstreamnt  +downstreamnt
atgccaactccatgctatatcagcatcgaagggaaaactcagggcaacatcaccgccggt
gccttcacgtctgattctgtcggcaacatctatgtcgaaggccacgaagacgaaatgctg
gtgcaggaattcaaacacgtggttaccgtgccgaccgacccgcagtctggtcagccatct
ggccagcgcgtgcacaagccgttcaaattcaccgtcgcgctgaacaaagccgttccactg
ctgtacaacgcactgtctaccggtgaaatgctgccgaccacaaccctgaagtggtatcgc
acctcggtggaaggcaagcaggagcacttcttctctaccatcctgaccgatgccaccatc
gtggatatcgactgcaaaatgccacactgccaggatccgtccaagctggattacacccaa
ctgattgaagtgtcgctggcttaccgcaaaatcgactgggaacacaccgtggccggcacg
tccggctccgatgactggcgtgcgccggtcgaagcgtaa

DBGET integrated database retrieval system