KEGG   Pectobacterium atrosepticum SCRI1043: ECA4276
Entry
ECA4276           CDS       T00186                                 

Definition
(GenBank) Rhs-family protein
  KO
K11904  type VI secretion system secreted protein VgrG
Organism
eca  Pectobacterium atrosepticum SCRI1043
Pathway
eca03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:eca00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    ECA4276
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:eca02044]
    ECA4276
Secretion system [BR:eca02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   ECA4276
SSDB
Motif
Pfam: Phage_GPD Phage_base_V Gp5_C Phage_Mu_Gp45
Other DBs
NCBI-ProteinID: CAG77173
GeneDB: ECA4276
UniProt: Q6CZ77
Position
4790693..4792522
AA seq 609 aa
MANSTGLQFTVKVGALPAPTFAVVDFQLSEALNRPFALSLNLASALPDVDFGAVLDQPCE
LLVWYEGELKRRVSGIISAFAQGDTGFRRTRYQMEVRPALWRLGLRTNARIFQAQKPEAI
IGTLLEEAGITDYAFALRHEHAPREYCVQYRESDLAFVTRLAAEEGLYFFHEFEEGKHRV
IFADDAGALAKGPELFFNLANQGLSEGDYVRRFRYAETVSTAEVALKDYSFKTPAYSLLH
SKISGKLDHQRESYQHYDYPGRFKQDPSGKAFTGYRLDALRANAMAGSGESNAAMLMPGN
SFTLTEHPNPVLNTGWQLVAIIHSGQQPQALEEESGGEPTTYSNSFEVISAKSTWRADLP
YKPMVDGPQIATVVGPAGEEIYCDEYGRIKLQFPWDRYGSSDDQSSCWVRVSQGWAGGQY
GLIAIPRIGHEVIVSFLEGDPDQPIVTGRTFHATNPSPYPLPANKTRTSLRTSTHKGAGF
NELRFEDQAGQEEVFIHAQKDMNTVVLNNRTTSVAADHTESVGGNQAMSVVKDQSTEIQG
HQNIAVTKNRSTTVDDNDSLQVKNNIAIQSQEGDILIATKGGFIGISADGVINIKGSHIV
VNGQQIDLN
NT seq 1830 nt   +upstreamnt  +downstreamnt
gtggcaaacagtacaggattacagttcacggtaaaggtcggtgcattgcccgccccgacg
tttgcggtggtggattttcagctcagcgaggcgcttaaccggccatttgccttgtcgctg
aatctggcaagtgccttgccggatgtggatttcggtgcggtgctcgaccaaccgtgtgag
ttgctggtgtggtacgaaggcgaactaaagcgccgagtgagcgggattatcagcgccttt
gcgcagggggacacgggctttcgtcgcacgcgctatcagatggaagtccgtccggccttg
tggcgactgggattacgtaccaacgcccgcatctttcaggcgcaaaagccggaagcgatt
atcggcacactgctggaagaagcagggattaccgactacgcctttgcgctgcgtcatgag
cacgcgccccgggaatactgcgtgcaatatcgggaaagcgatttggcgtttgtcacccga
ctggccgcagaggaagggttgtacttctttcacgagtttgaagaaggcaaacaccgagtc
atctttgccgatgatgcaggcgcattggcaaaaggcccagagctgttcttcaacctcgcc
aaccaggggctaagcgaaggcgactatgtgcgtcgtttccgctacgccgaaacagtcagc
accgcagaagtggcactcaaagactatagcttcaaaacccccgcctacagcctgctgcac
agcaagataagtggcaaactggaccatcagcgcgaaagctaccagcactatgactaccca
gggcgcttcaaacaggacccgagcggcaaggcgtttaccggctaccgactggacgcgtta
cgcgcgaatgccatggcgggttcaggcgaatccaatgccgcgatgctgatgccaggcaac
agctttaccctcaccgaacaccccaaccccgtgctcaataccggctggcagttggtggcc
attatccacagcgggcaacagccacaagcgctggaagaagaaagcggcggcgaaccgacc
acctacagcaacagctttgaggttatcagtgccaaaagcacctggcgtgcggatttgccg
tacaaaccgatggtagacggcccgcagatcgcgacggtcgtcggccccgcaggggaagaa
atctactgcgacgaatacggcagaatcaaactgcaattcccgtgggaccgctacggctcc
agtgatgaccagagttcgtgctgggtgcgggtgagtcagggttgggcaggcggccagtac
ggcttgattgccattccacgcatcggccatgaagtgattgtcagcttcctcgaaggcgac
ccagaccagccaattgtcactggcaggacgttccatgccaccaatccgtcgccgtacccg
ctgcccgccaataagacacgcacctcgctgcgtacctcaacgcacaaaggggccgggttc
aacgaattgcgctttgaagatcaggccggtcaggaggaggtgtttattcatgcccagaag
gacatgaacaccgttgtgttgaataaccgcacaaccagtgtggcagctgaccataccgaa
agcgtcggcggaaatcaggcaatgtcggtggtgaaagaccaatctaccgagattcaaggg
catcagaatatcgccgtcaccaaaaaccgcagcaccaccgtggatgacaacgactccctg
caggtgaaaaacaacatcgccattcaatcacaggagggcgacatcctaattgccaccaaa
ggcggttttattggtatcagcgccgatggcgtcatcaacatcaagggcagccacattgtg
gtaaatggccagcaaatcgacctgaactga

DBGET integrated database retrieval system