KEGG   Pectobacterium atrosepticum SCRI1043: ECA4278Help
Entry
ECA4278           CDS       T00186                                 

Definition
(GenBank) Rhs-family protein
Organism
eca  Pectobacterium atrosepticum SCRI1043
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: RHS_repeat PAAR_motif RHS DUF4150
Motif
Other DBs
NCBI-ProteinID: CAG77175
GeneDB: ECA4278
UniProt: Q6CZ75
Position
4792990..4797273
Genome map
AA seq 1427 aa AA seqDB search
MRDEILARIARVGAMHAGNRPTLPPDLPAPGSGSPPTSPDKPIKHSSFLGALLGAVAGAL
VAAAVAAVAVALVGVTGGLAIALVGGLAVLGAGSLISAVSGRVSAMVDSASPPAGAVADG
SPNVSVEGNPVSRAEVDAVACTKHSGPQLIAQGSETVFVNGHPAARIGDKTVCGATIKEG
ASTVFFGSGQATVLEIQDEFSGWQKALLIAVEFLVPPTRGLFRGLGKLFFRGPKAVMKGL
GAGALWAGKRFKQKTRCATRAFKANKGRARVTQAAKAFKKDPVYIASGEVIENRTDIELG
QTLPLVFERTYRTASSHVGLLGHGWQDSWSEVATVSRDDGDTHVVITLAQGYNIDFTFGV
GTTVVYCAEYPEFKLVRRHNGFHLWHRDSQTWRAFTVRQDDQLLLSAITDNHFNRIDFIR
DPKGYLRKVQHSDGIELLLVWQGEFLRQVQRIDGGQKTVLAEYRQDEQGRLIEADAAHAY
HLFYEYDNHNRLARWHDNDQTWAQYEYDHQGCCIYTTCADGYLTANFEYLADRVVMTDGL
GQRHEYGFNDLYLMTWEKSPLGHITRFEYDDVGNLLREISPAGRMVEFAYLGDSGLVSTF
TDGSGHQWHYDYDDSDRLTSITDPLGRNWVWQYDTKGNPQSLTGPDNSEVHFAWNRYGLL
TEVSDQGGQVQASLFYDHRQRLLSATDAESRTQQLRYDQQDRLTTWTRPDGSTYRLGYRR
ASWKLPEQLLRPDDKQEQRQYDKHNNLLNYTDGNGAVWRQTYGPFDLLTSRTDAEGRTWR
YEYDKESQQLVAVIAPDGNRWQWWLDADARVIREQDMAGTETRYGYDEDGHCISIHNGEG
ETRHFLYDGRGLLIKETAPDDTLHYRYDGAGRLTEVTSATSYIQLSYDVRDRVVQERNSG
TEIRRHYQAESDAVTRSLYWEGEESSAALTSTFRYSATGELRQVQLPDDAELTLAHDAAG
REAARNSNGGFMQQREYDAMGWLTREMSGQQRDGRLQAEQSREHLYDGAGNLTGTRHNRE
AEGYRLDASGRVLTVLSGGTGRTVNTEEEYRYTRTGLPQDATRLTEWQASRLIQRDDTHY
QYDKAGRLIRKQVVQPGYRPQVWHYRWDSRNQLRVVDTPTGERWFYRYDPFGRRTGKRCD
QKAEDIRYLWDGDQIAEVRHYRENQLISRRHWVHNGWELLVQQRQNTDGNWETDFVTSSH
NGEPQAIFNQAGELRWQAPRTNLWGHRTTDNTESLDPGLAFAGQYRDEESGLCYNRFRYY
DPSGGCYISPDPIGIRGGLNLYAYVKNPVNWIDPKGLAGCNIVHRAVTPEQAASIRAGNG
ISRPTPYHRTTPTQHVAGAPHSRDPWISTTRSQSTAEYFATHGGTQAANPIVNIDLSKIP
SDKILDVSNAQKAAEHLQTPFTRNVAAAHQEVLIFGEIPSEAIIGFL
NT seq 4284 nt NT seq  +upstreamnt  +downstreamnt
atgcgtgatgaaattctggctcgtattgcgcgggtgggtgcgatgcacgccggcaaccgc
cccacgctgccgcccgatttacccgcacccggcagtggttctccccccacttcaccggac
aagcccatcaaacacagcagctttctgggggcgttgctcggtgccgttgccggggcccta
gtggcggcagcagttgccgcggtcgcggtcgcgttggtcggggtgacgggcgggctggcg
attgcactggtaggcggattggcggtactgggggcgggtagtctgatatctgcggtaagt
ggccgggtatccgccatggtagacagcgcctcgccgcccgccggagcggtggctgacggt
tcacctaacgtgtctgttgaaggcaaccctgtatcccgggcggaagtcgatgcagtggcg
tgtaccaaacatagcggcccgcaactcattgcacagggcagcgaaaccgtcttcgttaac
ggtcatccggccgcgcggataggcgataaaaccgtgtgtggtgctaccatcaaggaagga
gcatctaccgtattctttggctccggacaggctacggtactggagatacaagatgagttc
agcggttggcagaaagcgctgctgattgcggtggaatttcttgtgccaccgacgcgtggg
ttatttcgcgggctggggaaattattctttcgcggccctaaagcggtcatgaaagggctg
ggtgccggagctctctgggcgggtaaacgctttaagcaaaagacacgctgtgccacccgc
gcatttaaggcgaacaaaggccgggcgcgggtgacccaagcggccaaagccttcaagaaa
gacccagtgtatatcgccagcggcgaggtgattgaaaaccgcactgatatcgaactgggg
cagactcttccactggtgttcgaacgcacctaccgtaccgcctcttcacatgtcggatta
ttaggccatggctggcaggatagctggagcgaagtcgctaccgtcagccgtgatgacggc
gacacccatgtagtcattacactggcacagggctacaacatcgatttcaccttcggggtg
ggcactacggtggtgtactgcgccgaatacccggagttcaaactagttaggcggcataac
ggctttcacctgtggcaccgtgacagccagacctggcgtgcgtttaccgtcaggcaggat
gaccagctattgttgtcggccatcactgacaaccatttcaaccgaatcgattttatccgc
gaccccaaaggctacctgcgcaaggtgcagcacagcgacggcatcgagctgctgctggta
tggcaaggggaatttctccgccaggtgcaacgtatcgacggcgggcagaaaaccgtgctg
gccgaataccggcaggatgaacaagggagactgatcgaggccgatgcggcgcatgcctat
cacctgttctacgagtacgataaccacaaccgcttggcgcgctggcacgacaacgaccag
acctgggcacagtatgaatatgaccatcaggggtgctgcatttacaccacctgcgccgac
ggctacctgaccgccaacttcgagtatctggcagaccgcgtggtgatgacagacgggctg
ggacaacgccatgaatatggctttaatgacctgtacctgatgacatgggagaaatccccg
ctcggccatatcacccgctttgagtatgacgatgtcggtaatctgctacgggaaatctcc
cctgcgggccggatggtggaatttgcctatctgggcgacagcgggctggtcagtaccttc
accgatggcagtggccatcaatggcattacgactatgacgacagcgatcgcctcaccagt
atcaccgaccctctcgggcgcaactgggtctggcagtacgacacgaagggcaatccgcaa
agcctgaccgggccggacaacagcgaagtgcattttgcgtggaaccgctacggcctgctg
accgaagtcagtgaccaaggtggacaggtgcaggccagtctgttttacgaccatcgacag
cgcctgctcagtgccacggatgcggagtcccgcactcaacaactacgctacgaccaacag
gacagactgaccacctggacacgcccggacggttccacctatcgcttgggttatcgccgt
gccagttggaaactgccggaacaactgctacgcccagacgacaagcaagaacagcgtcaa
tacgacaaacacaacaacctactgaattacactgatggcaacggcgcggtttggcggcaa
acctatggcccattcgatcttctgacgtcccgtaccgatgcggaaggccgcacctggcgt
tacgagtacgacaaagagagccaacaactcgtcgctgttatcgccccagatgggaaccgc
tggcaatggtggttggatgccgatgcacgggttatccgcgagcaggatatggctggcacc
gaaactcgctacggctatgacgaggatggccactgcattagcatccacaacggcgaaggc
gaaacccgccacttcctgtacgacggacgcgggctactcatcaaagaaaccgcaccggac
gatacgctgcactaccgctacgatggggcaggccgacttactgaagtgacgtctgcgacc
agctatatccagttgtcgtatgacgtacgagaccgagtggtgcaggaacggaacagcgga
acagaaatccgacgccactatcaggcagagtctgacgccgttacccgcagcttgtactgg
gaaggcgaagagagcagcgcggcactcaccagcaccttccgctatagtgccacgggtgaa
ctgcggcaggtgcagttgccggatgacgcagagctaacgttggctcacgacgccgcagga
cgagaagccgcccgaaatagcaacggcggctttatgcagcagcgcgaatacgacgccatg
ggctggctgacgcgcgagatgagtgggcagcagcgggatggtcgtttacaggccgaacag
agccgtgaacatttgtatgatggcgcaggcaacctaacgggcacccggcacaaccgcgag
gccgaaggctaccggttggatgccagcggacgagtgctaaccgtcctgagcggcggcaca
ggccgtaccgtcaataccgaagaagaataccgctacacccgcaccggcctgccgcaggac
gccacaagattgaccgagtggcaagcgagcaggcttattcagcgtgacgatacccactat
cagtacgacaaagccggacggctgatacgcaaacaggtggtacagccaggctaccggccg
caggtttggcactaccgctgggacagtcgtaaccagctcagagtggtggatacgccaacg
ggtgagcgctggttctaccgttacgacccattcgggcgacgcaccggcaaacgctgtgac
cagaaagcagaagacatccgttacctctgggacggcgaccagatagctgaagtgcggcat
taccgcgaaaaccagctcatcagccgccgccactgggtacacaatggctgggagttgctg
gtgcaacagcgccagaataccgacgggaattgggagacggattttgtcaccagcagccat
aacggcgagccgcaggctatctttaatcaggctggtgagcttcgctggcaggcgccgcgc
acgaacttatgggggcaccggactacagataatactgaaagtctcgatccggggctggca
tttgctgggcaataccgtgacgaagaaagtggcttatgctataaccgatttcggtattat
gatccaagcggtggttgctatatctcacctgacccgatagggataagaggtggtcttaac
ctttatgcgtatgttaaaaaccctgtaaattggatcgatccgaaagggttagctggatgt
aatatagtccatagggcggtgactcctgaacaagcagcaagtatccgagcaggcaatgga
atatcaaggccgactccatatcatagaacgacaccgactcagcatgtagcaggagcaccg
cactcgcgtgatccgtggatatcaacaactagaagtcaatcaacagcagaatacttcgcc
actcatggtggaacccaagcagcaaatccaattgttaatatagatctgtctaaaattccg
agcgataagattttagatgtatcaaacgctcaaaaggctgcggaacatttgcagactcca
ttcacccgaaatgtagcggcagcccaccaagaagtattaatctttggagaaataccatcg
gaagcgataattggatttttatag

DBGET integrated database retrieval system