KEGG   Enterobacter cancerogenus: CWI88_12180Help
Entry
CWI88_12180       CDS       T05545                                 

Gene name
paaF
Definition
(GenBank) phenylacetate--CoA ligase
  KO
K01912  phenylacetate-CoA ligase [EC:6.2.1.30]
Organism
ecan  Enterobacter cancerogenus
Pathway
ecan00360  Phenylalanine metabolism
ecan01100  Metabolic pathways
ecan01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:ecan00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00360 Phenylalanine metabolism
    CWI88_12180 (paaF)
Enzymes [BR:ecan01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.30  phenylacetate---CoA ligase
     CWI88_12180 (paaF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AMP-binding_C_2 AMP-binding
Motif
Other DBs
NCBI-ProteinID: AUJ81762
UniProt: A0A2I6E5X0
Position
complement(2560420..2561736)
Genome map
AA seq 438 aa AA seqDB search
MTNTTMLDPIETASLDELQTLQTERLKWTLHHAYSNVPMYKRKFDAAGVHPDDFNELADI
CKFPCTTKQDLRDNYPFDTFAVPMEQVVRIHASSGTTGKPTVVGYTQNDIDNWANIVARS
LRAAGGSAKDKIHVAYGYGLFTGGLGAHYGAERLGATVIPMSGGQTEKQAQLIRDFQPDM
IMVTPSYCLNLIEELERQMGGDASRCSLRVGVFGAEPWTQAMRREIEKRLGITALDIYGL
SEVMGPGVAMECLETADGPTIWEDHFYPEIVNPNDGTPLADGHQGELLFTTLTKEALPVI
RYRTRDLTRLLPGTARTMRRMDRISGRSDDMLIIRGVNVFPSQLEEEIVKFEHLSPHYQL
EVNRRGHLDSLSVKVELKESSLTLTHEQRCQVCHQLRHRIKSMVGISTDVTIVNCGSIPR
SEGKACRVFDLRKVAANG
NT seq 1317 nt NT seq  +upstreamnt  +downstreamnt
atgacaaatacaacaatgcttgatccgatcgaaaccgcctccctcgacgagctgcagacc
ctgcaaaccgagcgcctgaagtggacgctgcatcacgcctacagcaacgtcccgatgtac
aaacgcaagtttgacgcggcgggcgttcaccctgacgatttcaacgaactggcggatatc
tgcaaattcccgtgcaccaccaagcaggatttgcgcgataactatccgttcgacaccttt
gccgtgccgatggagcaggtggtgcgtattcacgcctcctccggcaccaccggcaagcca
accgtagtgggctatacccagaacgacatcgataactgggcaaatatcgtggcccgctcc
ctgcgtgccgccggaggcagtgcgaaagacaagattcacgtggcgtacggctatggcctg
tttaccggcgggctgggcgcgcattacggcgccgagcgcctgggggcgacggtgatcccg
atgtccggtggccagaccgagaaacaggcgcagctgatccgcgattttcagccggatatg
atcatggtgacgccttcctattgcctgaatctgatcgaagagctggagcgccagatgggc
ggcgacgccagccgctgctccctgcgtgtcggcgtgtttggtgcagagccctggacccag
gcgatgcgccgcgagatcgaaaaacgtctgggtatcaccgcgctggatatttacggtttg
tccgaagtcatggggccgggcgtggcgatggaatgtctggaaacggccgatggcccgacc
atctgggaagatcatttctatccggaaatcgtcaacccgaacgacgggacgccgctcgcc
gacggccatcagggcgaactgctgttcaccacgctgaccaaagaggcgctgccggtgatc
cgctaccgcacccgcgatctgacgcgtctgctgcccggcaccgcgcgcaccatgcgccgc
atggatcgcatcagcgggcgcagcgacgacatgctgatcatccgcggcgtgaacgtcttc
ccgtctcagctggaagaggagatcgttaagttcgaacatctctctccgcattaccagctg
gaggtgaaccgccgcgggcatcttgattcactttctgtgaaggtggagctaaaagagagc
agcttaaccctgacccacgaacagcgctgccaggtgtgccaccagctgcgccaccgcatc
aaatcgatggtggggatctcgaccgacgtgacgattgttaactgcggcagcatcccacgc
tcggaaggcaaggcgtgccgggtgtttgatttgcgtaaggtggcggcgaacggttga

DBGET integrated database retrieval system