KEGG   Enterobacter cancerogenus: CWI88_13700Help
Entry
CWI88_13700       CDS       T05545                                 

Definition
(GenBank) two-component system sensor histidine kinase PhoQ
  KO
K07637  two-component system, OmpR family, sensor histidine kinase PhoQ [EC:2.7.13.3]
Organism
ecan  Enterobacter cancerogenus
Pathway
ecan01503  Cationic antimicrobial peptide (CAMP) resistance
ecan02020  Two-component system
Brite
KEGG Orthology (KO) [BR:ecan00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    CWI88_13700
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01503 Cationic antimicrobial peptide (CAMP) resistance
    CWI88_13700
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:ecan01001]
    CWI88_13700
  09183 Protein families: signaling and cellular processes
   02022 Two-component system [BR:ecan02022]
    CWI88_13700
   01504 Antimicrobial resistance genes [BR:ecan01504]
    CWI88_13700
Enzymes [BR:ecan01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.13  Protein-histidine kinases
    2.7.13.3  histidine kinase
     CWI88_13700
Protein kinases [BR:ecan01001]
 Histidine kinases
  OmpR family
   CWI88_13700
Two-component system [BR:ecan02022]
 OmpR family
  PhoQ-PhoP (magnesium transport)
   CWI88_13700
Antimicrobial resistance genes [BR:ecan01504]
 Gene sets
  CAMP resistance modules
   Cationic antimicrobial peptide (CAMP) resistance, protease PgtE [MD:M00744]
    CWI88_13700
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PhoQ_Sensor HATPase_c HATPase_c_5 HAMP HisKA HATPase_c_2 HATPase_c_3 TcdB_N OmpH
Motif
Other DBs
NCBI-ProteinID: AUJ82039
UniProt: A0A2J7P4W2
Position
2863023..2864486
Genome map
AA seq 487 aa AA seqDB search
MKGIVRHLFPLSLRVRFLLATAAVVLVLSLSYGMVALVGYSVSFDKTTFRLLRGESNLFY
TLAKWEDNHITVDMPEHLNQQSPTLAMIYNEKGKLLWAQRDVPWLKKRIRPEWLKTNGFH
EIEADLNASSVLLRDDRSLQQKLNEIREDDDDTEMTHSVAINLYPATMNMPQLTIVVIDT
IPVELKRSYKVWSWFVYVLAANLLLVIPLLWIAAWWSLRPIESLAKEVRELEEHHREKLN
PETTRELTSLVRNLNRLLKSERERYDKYRTTLTDLTHSLKTPLAVMQSTLRSMRGEKLSV
DEAEPVMLEQISRISQQIGYYLHRASMRSGSALLSRELHPVAPLLDNLTSALNKVYQRKG
VNISLDISPEISFVGEKNDFMEVMGNLLDNACKYCLEFVEVSARQTDNELHIIVEDDGPG
IPHNKRDVVFDRGQRADTLRPGQGVGLSVAREIVDQYDGKIDTGDSLLGGARMEVIFGRQ
QPTSDNS
NT seq 1464 nt NT seq  +upstreamnt  +downstreamnt
atgaaagggatcgtacgccatcttttccccctctctttgcgggttcgctttctgctggcc
accgcagccgtggtgctggtgctctccctctcttatgggatggtggcgctggtcggctat
agcgtgagctttgataaaacgaccttccgcctgctacgtggcgaaagtaacctgttttac
accctggcgaagtgggaagataaccacatcaccgtggacatgcctgaacacctgaaccag
caaagtccaacgctggcgatgatttataacgaaaaaggcaaactgctgtgggcccagcgc
gatgtcccctggctgaaaaagcgtattcgcccggaatggctcaagaccaacggttttcat
gagattgaggccgaccttaacgcctccagcgtgttgctgcgcgacgatcgttctctgcag
caaaaactgaacgagatccgcgaggatgatgacgacacagaaatgacccactccgtcgcc
attaatctctatcctgccaccatgaatatgccacagctgactatcgtggtgatcgacacg
atcccggttgagcttaaacgctcttataaggtctggagctggttcgtgtacgttctggcg
gccaacctgctgctggtgatcccgcttctatggattgccgcgtggtggagcctgcgccca
attgagtcgctggcgaaagaggtacgtgagctggaagagcatcatcgtgagaagcttaac
cccgaaaccacgcgcgaactgaccagcctggtgcgtaacctcaaccgtctgctgaaaagc
gagcgggagcgctatgataaataccgcaccacgcttaccgaccttacccatagcctgaaa
acgccgctggcggtgatgcagagtacgctgcggtcgatgcgcggcgaaaagcttagcgtc
gacgaggccgagccggtgatgctggagcaaatcagccgtatctcccagcaaattggctac
tacctgcaccgggccagcatgcgctccggcagcgcgttgctcagccgcgaactgcacccg
gtcgcgccgctgctggataacctgacgtcggcgctgaacaaggtttaccagcgtaaaggg
gtgaatattagcctggatatttcgccggagatcagcttcgtcggtgaaaaaaatgatttc
atggaagtgatgggcaacctgctcgataacgcctgtaaatattgcctggagtttgtggaa
gtctccgcccgccagacggataacgagctgcacattatcgtcgaggatgatggtccgggt
attccccataacaaacgcgatgtcgttttcgatcgcggacagcgtgccgataccctgcga
cccggccagggcgtgggattatccgtcgcacgcgagattgtcgatcaatacgatggcaag
atagacaccggcgatagcctgctcggcggcgcgcgaatggaagtgatttttggccgtcag
cagcctacatcggataatagttaa

DBGET integrated database retrieval system